Recombinant Human p53 apoptosis effector related to PMP-22 (PERP)

In Stock
Code CSB-CF839325HU
Abbreviation Recombinant Human PERP protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
PERP; KCP1; KRTCAP1; PIGPC1; THW; p53 apoptosis effector related to PMP-22; Keratinocyte-associated protein 1; KCP-1; P53-induced protein PIGPC1; Transmembrane protein THW
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-193aa
Target Protein Sequence
MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.4kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway.
Gene References into Functions
  1. Downregulation of desmosomal formation transcripts including PERP may contribute to the aggressive phenotype seen in sparsely granulated GH pituitary tumors and their behavior in response to surgery and medical therapy. PMID: 28323918
  2. Expression of p63-tGFP induces apoptosis with marked increase in PERP expression and associated p53 accumulation. Lack of p63 contributes to reduced PERP levels and impaired p53-mediated apoptosis in UM. PMID: 27584665
  3. Salmonella Typhimurium type III secreted effector SipC significantly contributes to PERP redistribution to the apical membrane surface. PMID: 27078059
  4. The authors identified the tetraspanning membrane protein, p53 effector related to PMP-22 (PERP), as a Salmonella typhimurium SipA binding partner. PMID: 25486861
  5. Decreased PERP expression on peripheral blood mononuclear cells from patient with rheumatoid arthritis negatively correlates with disease activity. PMID: 24066004
  6. Perp expression is reduced in human breast cancer cell lines PMID: 22515648
  7. PERP expression stabilizes active p53 via modulation of p53-MDM2 interaction in uveal melanoma cells. PMID: 21451571
  8. Our comprehensive mutation scanning did not identify any Arrhythmogenic right ventricular cardiomyopathy (ARVC) causing mutations. PMID: 21254927
  9. Data suggest a temporal sequence whereby PERP loss occurs before E-cadherin loss in the progression of human SCC. PMID: 20975948
  10. findings underline the apoptotic pathway mediated by PERP as a critical mechanism employed by uveal melanoma tumours to modulate susceptibility to apoptosis PMID: 19040420
  11. pemphigus vulgaris autoantibodies disrupt Perp expression at the membrane and trigger its internalization along with DSG3 into the endosomal pathway, where it is ultimately targeted to the lysosome for degradation PMID: 19158843
  12. We demonstrate here that PERP induction is in fact compromised with some, but not all, Ankyloblepharon Ectodermal Dysplasia and Cleft Lip/Palate, AEC-patient derived TP63 mutants. PMID: 19353588
  13. A paper describing the identification of Perp (p53 Apoptosis Effector Related to PMP22). Perp was found as a novel target gene of the p53 tumor suppressor, which is selectively induced during apoptosis compared to cell cycle arrest. PMID: 10733530

Show More

Hide All

Subcellular Location
Cell junction, desmosome. Cell membrane; Multi-pass membrane protein.
Protein Families
TMEM47 family
Tissue Specificity
Expressed in skin, heart, placental, liver, pancreas, keratinocytes and dermal fibroblasts.
Database Links

HGNC: 17637

OMIM: 609301

KEGG: hsa:64065

STRING: 9606.ENSP00000397157

UniGene: Hs.201446

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*