Name: Recombinant Human p53 apoptosis effector related to PMP-22(PERP)-VLPs
Brand: CUSABIO
SKU: CSB-MP839325HU

Product Details

Target Names	PERP
Uniprot No.	Q96FX8
Research Area	Cell Biology
Alternative Names	PERP; KCP1; KRTCAP1; PIGPC1; THW; p53 apoptosis effector related to PMP-22; Keratinocyte-associated protein 1; KCP-1; P53-induced protein PIGPC1; Transmembrane protein THW
Species	Homo sapiens (Human)
Source	Mammalian cell
Expression Region	1-193aa
Target Protein Sequence	MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info	C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form	Lyophilized powder Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer	Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA	Please contact us to get it.

Target Background

Function	Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway.
Gene References into Functions	Downregulation of desmosomal formation transcripts including PERP may contribute to the aggressive phenotype seen in sparsely granulated GH pituitary tumors and their behavior in response to surgery and medical therapy. PMID: 28323918 Expression of p63-tGFP induces apoptosis with marked increase in PERP expression and associated p53 accumulation. Lack of p63 contributes to reduced PERP levels and impaired p53-mediated apoptosis in UM. PMID: 27584665 Salmonella Typhimurium type III secreted effector SipC significantly contributes to PERP redistribution to the apical membrane surface. PMID: 27078059 The authors identified the tetraspanning membrane protein, p53 effector related to PMP-22 (PERP), as a Salmonella typhimurium SipA binding partner. PMID: 25486861 Decreased PERP expression on peripheral blood mononuclear cells from patient with rheumatoid arthritis negatively correlates with disease activity. PMID: 24066004 Perp expression is reduced in human breast cancer cell lines PMID: 22515648 PERP expression stabilizes active p53 via modulation of p53-MDM2 interaction in uveal melanoma cells. PMID: 21451571 Our comprehensive mutation scanning did not identify any Arrhythmogenic right ventricular cardiomyopathy (ARVC) causing mutations. PMID: 21254927 Data suggest a temporal sequence whereby PERP loss occurs before E-cadherin loss in the progression of human SCC. PMID: 20975948 findings underline the apoptotic pathway mediated by PERP as a critical mechanism employed by uveal melanoma tumours to modulate susceptibility to apoptosis PMID: 19040420 pemphigus vulgaris autoantibodies disrupt Perp expression at the membrane and trigger its internalization along with DSG3 into the endosomal pathway, where it is ultimately targeted to the lysosome for degradation PMID: 19158843 We demonstrate here that PERP induction is in fact compromised with some, but not all, Ankyloblepharon Ectodermal Dysplasia and Cleft Lip/Palate, AEC-patient derived TP63 mutants. PMID: 19353588 A paper describing the identification of Perp (p53 Apoptosis Effector Related to PMP22). Perp was found as a novel target gene of the p53 tumor suppressor, which is selectively induced during apoptosis compared to cell cycle arrest. PMID: 10733530 Show More Hide All
Subcellular Location	Cell junction, desmosome. Cell membrane; Multi-pass membrane protein.
Protein Families	TMEM47 family
Tissue Specificity	Expressed in skin, heart, placental, liver, pancreas, keratinocytes and dermal fibroblasts.
Database Links	HGNC: 17637 OMIM: 609301 KEGG: hsa:64065 STRING: 9606.ENSP00000397157 UniGene: Hs.201446

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Recombinant Human p53 apoptosis effector related to PMP-22(PERP)-VLPs

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage

Code	CSB-MP839325HU
Size
Have Questions?	Leave a Message or Start an on-line Chat