Recombinant Human p53 apoptosis effector related to PMP-22(PERP)-VLPs

Code CSB-MP839325HU
Size
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names PERP
Uniprot No. Q96FX8
Research Area Cell Biology
Alternative Names PERP; KCP1; KRTCAP1; PIGPC1; THW; p53 apoptosis effector related to PMP-22; Keratinocyte-associated protein 1; KCP-1; P53-induced protein PIGPC1; Transmembrane protein THW
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 1-193aa
Target Protein Sequence MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway.
Gene References into Functions
  1. Downregulation of desmosomal formation transcripts including PERP may contribute to the aggressive phenotype seen in sparsely granulated GH pituitary tumors and their behavior in response to surgery and medical therapy. PMID: 28323918
  2. Expression of p63-tGFP induces apoptosis with marked increase in PERP expression and associated p53 accumulation. Lack of p63 contributes to reduced PERP levels and impaired p53-mediated apoptosis in UM. PMID: 27584665
  3. Salmonella Typhimurium type III secreted effector SipC significantly contributes to PERP redistribution to the apical membrane surface. PMID: 27078059
  4. The authors identified the tetraspanning membrane protein, p53 effector related to PMP-22 (PERP), as a Salmonella typhimurium SipA binding partner. PMID: 25486861
  5. Decreased PERP expression on peripheral blood mononuclear cells from patient with rheumatoid arthritis negatively correlates with disease activity. PMID: 24066004
  6. Perp expression is reduced in human breast cancer cell lines PMID: 22515648
  7. PERP expression stabilizes active p53 via modulation of p53-MDM2 interaction in uveal melanoma cells. PMID: 21451571
  8. Our comprehensive mutation scanning did not identify any Arrhythmogenic right ventricular cardiomyopathy (ARVC) causing mutations. PMID: 21254927
  9. Data suggest a temporal sequence whereby PERP loss occurs before E-cadherin loss in the progression of human SCC. PMID: 20975948
  10. findings underline the apoptotic pathway mediated by PERP as a critical mechanism employed by uveal melanoma tumours to modulate susceptibility to apoptosis PMID: 19040420
  11. pemphigus vulgaris autoantibodies disrupt Perp expression at the membrane and trigger its internalization along with DSG3 into the endosomal pathway, where it is ultimately targeted to the lysosome for degradation PMID: 19158843
  12. We demonstrate here that PERP induction is in fact compromised with some, but not all, Ankyloblepharon Ectodermal Dysplasia and Cleft Lip/Palate, AEC-patient derived TP63 mutants. PMID: 19353588
  13. A paper describing the identification of Perp (p53 Apoptosis Effector Related to PMP22). Perp was found as a novel target gene of the p53 tumor suppressor, which is selectively induced during apoptosis compared to cell cycle arrest. PMID: 10733530

Show More

Hide All

Subcellular Location Cell junction, desmosome. Cell membrane; Multi-pass membrane protein.
Protein Families TMEM47 family
Tissue Specificity Expressed in skin, heart, placental, liver, pancreas, keratinocytes and dermal fibroblasts.
Database Links

HGNC: 17637

OMIM: 609301

KEGG: hsa:64065

STRING: 9606.ENSP00000397157

UniGene: Hs.201446

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1