Recombinant Lactococcus lactis Lipoprotein signal peptidase(lspA)

Code CSB-CF2619Ba
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A0A089ZE57
Relevance This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MKKLLSLVIIVVGIVADQIFKNWIVANIQLGDTEKIWPNVLSLTYIKNDGAAWSSFSGQQWFFLVLTPIVLVVALWFLWKKMAQNWYFIGLTLIIAGALGNFIDRIRQGFVVDMFQTEFINFPIFNIADILLSVGFVLLFIAILTDKETK
Research Area Others
Source in vitro E.coli expression system
Protein Names Prolipoprotein signal peptidase Signal peptidase II
Expression Region 1-150aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 19.9 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.