Recombinant Limnocottus bergianus Rhodopsin(rho)

Code CSB-CF019681LPQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O42427
Storage Buffer Tris-based buffer,50% glycerol
Species Limnocottus bergianus
Sequence YLVNPAGYAALGAYMFLLILIGSPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYSVLGRLGCILEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFSWVMALACAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFI VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRPEKEVTRMVVIMVIAFLVCCLPNA SVAWWIFCNQGSDFGPIFMTLPSFFAKSAAIYNPMIYICMNKQFRHCMI
Source in vitro E.coli expression system
Gene Names rho
Protein Names Recommended name: Rhodopsin
Expression Region 1-289
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor required for image-forming vision at low light intensity. While most salt water fish species use retinal as chromophore, most freshwater fish use 3-dehydroretinal, or a mixture of retinal and 3-dehydroretinal (By similarity). Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin and terminates signaling (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families G-protein coupled receptor 1 family, Opsin subfamily

Related Products

rho Proteins

rho Proteins for Limnocottus bergianus

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.