Recombinant Loligo subulata Rhodopsin(RHO)

Code CSB-CF019681LAAK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q17094
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Alloteuthis subulata (Squid) (Loligo subulata)
Sequence NETWWYNPYMDIHSHWKQFDQVPAAVYYSLGIFIAICGIIGCAGNGIVIYLFTKTKSLQT PANMFIINLAFSDFTFSLVNGFPMMTISCFLKHWVFGQAACKVYGLIGGIFGLTSIMTMT MISIDRYNVIRRPMSASKKMSHRKAFIMIVFVWIWSTIWAIGPIFGWGAYQLEGVLCNCS FDYITRDASTRSNIVCMYIFAFMFPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELR KAQAGASAEMKLAKISIVIVTQSLLSWSPYAIVALLAQFGPIEWVTPYAAQLPVMFAKAS AIHNPMIYSVSHPKFREAIASNFPWILTCCQYDEKEIEDDKDAEAEIPAAEQSGGESVDA AQMKEMMAMMQKMQAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPPP QGPPPQGPPPQAAPPQGVD
Source in vitro E.coli expression system
Gene Names RHO
Protein Names Recommended name: Rhodopsin
Expression Region 1-439
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor required for image-forming vision at low light intensity. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Signaling mediates the activation of phospholipase C (By similarity). Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin and terminates signaling (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily

Related Products

RHO Proteins

RHO Proteins for Alloteuthis subulata (Squid) (Loligo subulata)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.