Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF019681LJC |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q68J47 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Loxodonta africana (African elephant) |
| Sequence | MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKNVRTPLNYILLNLAVANHFMVFGGFTTTLYTSLHGYFVFGSTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMTIIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSDFGPILMTLPAFFAKSSAI YNPVIYIMMNKQFRNCMLTTICCGKNPFGEEEGSTTASKTETSQVAPA |
| Source | in vitro E.coli expression system |
| Gene Names | RHO |
| Protein Names | Recommended name: Rhodopsin |
| Expression Region | 1-348 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth (By similarity). Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins |
| Subcellular Location | Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment |
| Protein Families | G-protein coupled receptor 1 family, Opsin subfamily |
| Database Links |
KEGG: lav:100141369 STRING: 9785.ENSLAFP00000001142 |
RHO Proteins for Loxodonta africana (African elephant)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP019681LJC1 CSB-EP019681LJC1 CSB-BP019681LJC1 CSB-MP019681LJC1 |
Recombinant Loxodonta africana Rhodopsin(RHO),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Dog Caveolin-1(CAV1)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Mouse Pyridoxal phosphate phosphatase(Pdxp)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Complement C1q subcomponent subunit A(C1QA)
Express system: Baculovirus
Species: Homo sapiens (Human)
Recombinant Human Cellular tumor antigen p53(TP53)
Express system: Yeast
Species: Homo sapiens (Human)
