Product Details

Target Names

ADRB1

Uniprot No.

P07700

Alternative Names

ADRB1; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor; Beta-T

Species

Meleagris gallopavo (Wild turkey)

Expression Region

1-483

Target Protein Sequence

MGDGWLPPDCGPHNRSGGGGATAAPTGSRQVSAELLSQQWEAGMSLLMALVVLLIVAGNV LVIAAIGRTQRLQTLTNLFITSLACADLVMGLLVVPFGATLVVRGTWLWGSFLCECWTSL DVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMH WWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVYLRVYREAKEQIRK IDRCEGRFYGSQEQPQPPPLPQHQPILGNGRASKRKTSRVMAMREHKALKTLGIIMGVFT LCWLPFFLVNIVNVFNRDLVPDWLFVFFNWLGYANSAFNPIIYCRSPDFRKAFKRLLCFP RKADRRLHAGGQPAPLPGGFISTLGSPEHSPGGTWSDCNGGTRGGSESSLEERHSKTSRS ESKMEREKNILATTRFYCTFLGNGDKAVFCTVLRIVKLFEDATCTCPHTHKLKMKWRFKQ HQA

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. In dorsal pons neurons, involved in the regulation of sleep/wake behaviors.

Gene References into Functions

In both sexes of Crollwitzer turkey hearts, the beta1-AR density decreased with age but significance was reached in male cardiac chambers. PMID: 29253207
backbone NMR reveals allosteric signal transduction networks in the beta1-adrenergic receptor PMID: 26840483
2.1 A resolution structure of cyanopindolol-bound beta1-adrenoceptor identifies an intramembrane Na+ ion that stabilises the ligand-free receptor PMID: 24663151
Monoclonal anti-beta1-adrenergic receptor antibodies activate G protein signaling in the absence of beta-arrestin recruitment PMID: 24253107
Although the combination of mutations severely reduced the activation ability of ADRB1, the final crystallised receptor (beta36-m23) was still a functional receptor capable of binding agonists and antagonists and activating cellular agonist responses. PMID: 21547538
2.7 A resolution crystal structure of turkey beta(1)-adrenergic receptor in complex with the high-affinity antagonist cyanopindolol PMID: 18594507
Molecular simulations of beta-1 AR show formation of an ionic lock, with the cytoplasmatic end of transmembrane (TM)6 helix approaching TM3 resulting in an equilibrium geometry that is stabilized by direct interaction of arginine and glutamate. PMID: 19378975
The all-atom force-field energy function was used to calculate a stability score to detect stabilizing point mutations in G-protein coupled receptors. PMID: 20643076
four crystal structures of the thermostabilized turkey beta(1)-adrenergic receptor bound to the full agonists carmoterol and isoprenaline and the partial agonists salbutamol and dobutamine PMID: 21228877

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Early endosome.

Protein Families

G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily

Database Links

KEGG: mgp:100303680

STRING: 9103.ENSMGAP00000011521

UniGene: Mga.4462

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF001391MQV
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Meleagris gallopavo Beta-1 adrenergic receptor (ADRB1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage