Recombinant Meleagris gallopavo Beta-1 adrenergic receptor(ADRB1)

Code CSB-CF001391MQV
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names ADRB1
Uniprot No. P07700
Alternative Names ADRB1Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor; Beta-T
Species Meleagris gallopavo (Wild turkey)
Expression Region 1-483
Target Protein Sequence MGDGWLPPDCGPHNRSGGGGATAAPTGSRQVSAELLSQQWEAGMSLLMALVVLLIVAGNV LVIAAIGRTQRLQTLTNLFITSLACADLVMGLLVVPFGATLVVRGTWLWGSFLCECWTSL DVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMH WWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVYLRVYREAKEQIRK IDRCEGRFYGSQEQPQPPPLPQHQPILGNGRASKRKTSRVMAMREHKALKTLGIIMGVFT LCWLPFFLVNIVNVFNRDLVPDWLFVFFNWLGYANSAFNPIIYCRSPDFRKAFKRLLCFP RKADRRLHAGGQPAPLPGGFISTLGSPEHSPGGTWSDCNGGTRGGSESSLEERHSKTSRS ESKMEREKNILATTRFYCTFLGNGDKAVFCTVLRIVKLFEDATCTCPHTHKLKMKWRFKQ HQA
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity.
Gene References into Functions
  1. In both sexes of Crollwitzer turkey hearts, the beta1-AR density decreased with age but significance was reached in male cardiac chambers. PMID: 29253207
  2. backbone NMR reveals allosteric signal transduction networks in the beta1-adrenergic receptor PMID: 26840483
  3. 2.1 A resolution structure of cyanopindolol-bound beta1-adrenoceptor identifies an intramembrane Na+ ion that stabilises the ligand-free receptor PMID: 24663151
  4. Monoclonal anti-beta1-adrenergic receptor antibodies activate G protein signaling in the absence of beta-arrestin recruitment PMID: 24253107
  5. Although the combination of mutations severely reduced the activation ability of ADRB1, the final crystallised receptor (beta36-m23) was still a functional receptor capable of binding agonists and antagonists and activating cellular agonist responses. PMID: 21547538
  6. 2.7 A resolution crystal structure of turkey beta(1)-adrenergic receptor in complex with the high-affinity antagonist cyanopindolol PMID: 18594507
  7. Molecular simulations of beta-1 AR show formation of an ionic lock, with the cytoplasmatic end of transmembrane (TM)6 helix approaching TM3 resulting in an equilibrium geometry that is stabilized by direct interaction of arginine and glutamate. PMID: 19378975
  8. The all-atom force-field energy function was used to calculate a stability score to detect stabilizing point mutations in G-protein coupled receptors. PMID: 20643076
  9. four crystal structures of the thermostabilized turkey beta(1)-adrenergic receptor bound to the full agonists carmoterol and isoprenaline and the partial agonists salbutamol and dobutamine PMID: 21228877

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein, Early endosome
Protein Families G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily
Database Links

KEGG: mgp:100303680

STRING: 9103.ENSMGAP00000011521

UniGene: Mga.4462

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1