Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase beta(Agpat2)

Code CSB-CF814318MO
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Agpat2
Uniprot No. Q8K3K7
Alternative Names Agpat2; 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; EC 2.3.1.51; 1-acylglycerol-3-phosphate O-acyltransferase 2; 1-AGP acyltransferase 2; 1-AGPAT 2; Lysophosphatidic acid acyltransferase beta; LPAAT-beta
Species Mus musculus (Mouse)
Expression Region 1-278
Target Protein Sequence MDPWPWLTAALLLLLLLVQLSRTARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNM SIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAK RELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGD LLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDAD VTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ
Protein Length full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
Gene References into Functions
  1. Adipogenically induced Agpat2(-/-) preadipocytes had fewer lipid-loaded cells and lower levels of adipocyte markers than wild type preadipocytes. PMID: 26417690
  2. Leptin ameliorates insulin resistance and hepatic steatosis in Agpat2-/- lipodystrophic mice independent of hepatocyte leptin receptors PMID: 24293639
  3. The lack of normal insulin signaling in Agpat2(-/-) livers allows unrestricted phosphatidic acid-induced gluconeogenesis. PMID: 24425876
  4. Data suggest that Agpat2 regulates adipogenesis through modulation of lipid metabolism/signal transduction, altering normal activation of phosphatidylinositol 3-kinase (PI3K)/protooncogene c-Akt and PPARgamma signaling in early stage of adipogenesis. PMID: 22872237
  5. the role of AGPAT1 or AGPAT2 in liver lipogenesis is minimal and that accumulation of liver fat is primarily a consequence of insulin resistance PMID: 21873652
  6. Loss of adipocytes by necrosis and apoptosis in Agpat2 null mice PMID: 21051554
  7. There is a prevalence of mutations in this enzymes among human lipodystrophies PMID: 12765973
  8. impaired AGPAT2 activity affects availability of phosphatidic acid (PA) for triacylglycerol synthesis but not overall PA synthesis nor utilization of PA for phospholipid synthesis PMID: 16495223
  9. The alternative monoacylglycerol pathway for triglyceride biosynthesis is activated in the absence of 1-acylglycerol-3-phosphate O-acyltransferase 2. PMID: 19187773

Show More

Hide All

Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families 1-acyl-sn-glycerol-3-phosphate acyltransferase family
Tissue Specificity Expressed at high levels in the liver, at intermediate levels in the kidney, gut, heart and skeletal muscles. Undetectable in brain and spleen.
Database Links

KEGG: mmu:67512

STRING: 10090.ENSMUSP00000028286

UniGene: Mm.24244

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1