Recombinant Mouse 5-hydroxytryptamine receptor 1A (Htr1a)

Code CSB-CF727053MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Htr1a
Uniprot No.
Alternative Names
Htr1a; Gpcr18; 5-hydroxytryptamine receptor 1A; 5-HT-1A; 5-HT1A; Serotonin receptor 1A
Species
Mus musculus (Mouse)
Expression Region
1-421
Target Protein Sequence
MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGAGT SFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAVRQGEDDATLEVIEVHRVGN SKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC R
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling inhibits adenylate cyclase activity and activates a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of 5-hydroxytryptamine release and in the regulation of dopamine and 5-hydroxytryptamine metabolism. Plays a role in the regulation of dopamine and 5-hydroxytryptamine levels in the brain, and thereby affects neural activity, mood and behavior. Plays a role in the response to anxiogenic stimuli.
Gene References into Functions
  1. 5-HT1AR KO affected anxiety in male mice, and fear memory and prepulse inhibition in female mice. 5-HT1AR genotype moderated the effects of maternal prenatal stress exposure on social behavior of male offspring and on activity levels of female offspring. Findings indicate that 5-HT1A receptor availability affect outcomes of the offspring resulting from maternal prenatal stress exposure sex-specifically. PMID: 29203227
  2. Under basal conditions, 5-HT1AR overexpressing animals presented high corticosterone levels and a lower mineralocorticoid/glucocorticoid receptor ratio. After pre-exposure to a single stressor, they showed a high anxiety-like response, a blunted increase in corticosterone levels, higher prefrontal c-Fos activation, and lack of downregulation of hippocampal long-term potentiation. PMID: 28777913
  3. activation of the 5-HT1A receptor during the postnatal period may reduce anxiety levels, but increase depression levels during adulthood via different multiple molecules in the mPFC and ventral hippocampus. PMID: 28483674
  4. Zn can modulate both presynaptic and postsynaptic 5-HT1ARs. PMID: 26660328
  5. 5-HT1A autoreceptor expression in serotonin neurons requires Freud-1 and is linked to anxiety/depression-like behavior. PMID: 29101244
  6. The sex dependence of Deaf1 function in mice is consistent with a greater role for 5-HT1A autoreceptors in sensitivity to depression in men. PMID: 27488351
  7. Results suggest that 5HT acting at 5HT1aR in the Kolliker-Fuse nucleus may modulate both the intrinsic and extrinsic sources of respiratory rhythm variability. PMID: 26840837
  8. a leading role of the postsynaptic 5-HT1AR in adult hippocampal neurogenesis and might open an important link to depression. PMID: 27693660
  9. Among patients with major depressive disorder, it was found that patients with the C/C genotype for the C(1019)G polymorphism of the 5-HT1A-R were significantly superior in retaining and retrieving information, in both working and episodic memory, than those with either the C/G or the G/G genotypes. PMID: 26780922
  10. the activation of TLR3 promotes the loss of RGCs and their axons by elevating Rtca levels in the retina. Also, the results presented in this study show that Rtca regulates JNK3 expression in the retina. PMID: 27727398
  11. Findings suggest an important role for 5-hydroxytryptamine 1A autoreceptors, and thus dorsal raphe nucleus, nucleus accumbens 5-hydroxytryptamine neuronal activity, in the etiology and vulnerability to cocaine reward and addiction. PMID: 26324408
  12. Findings indicate that cannabidiol could represent a novel fast antidepressant drug, via enhancing both serotonergic and glutamate cortical signalling through a 5-HT1A receptor-dependent mechanism. PMID: 26711860
  13. The results of this study suggested that the hallucinogen action of 5-MeO-DMT is mediated by simultaneous alterations of the activity of cerebral cortex also supporting a role of 5-HT(1A)-R stimulation in V1 and PFC. PMID: 26477571
  14. serotonin plays a fundamental role in arthritis through the regulation of the Th17/T-regulatory cell balance and osteoclastogenesis PMID: 26968113
  15. Results indicate that GIRK channels formed by GIRK2 subunits determine depression-related behaviors as well as basal and 5-HT1A receptor-mediated dorsal raphe neuronal activity PMID: 25956878
  16. Results indicate that postsynaptic 5-HT1A receptors exert a modulatory function in food intake in free-feeding and fasted mice, which for the first time shows an involvement of postsynaptic 5-HT1A receptors in feeding behavior PMID: 25781502
  17. It plays a key role in the enhancement of prefrontal dopamine release. PMID: 25727963
  18. 5HT1A receptors regulate glucose through brain mechanisms, but not through regulation of the hypophyseal-pituitary axis. PMID: 25446927
  19. It indicated that Correlation between nAChalpha4-, 5-HT1A- and 5-HT7-containing receptors and latencies on day 16 may point to a probable link in extinction mechanisms. PMID: 24837029
  20. There is enhanced capacity of 5-HT1A receptors to inhibit neurons in the prefrontal cortex in SERT-knockout mice. PMID: 25261781
  21. 5-HT1A and 5-HT2A receptors are able to modulate each other functional activity by means of bilateral functional cross-talk. PMID: 26080602
  22. impact of the 5-HT2A and the 5-HT1A receptor for different serotonin syndrome-like responses PMID: 25087754
  23. Results showed a difference in food intake between WT and 5-HT1A-R KO mice with differential expression of POMC, CART and GABAA beta2. A difference in body weight between WT and KO mice was associated with different expression levels of CART and GABAA beta2. PMID: 25130282
  24. Data indicate that 5-HT1A receptor mediated neuroproliferative effect at P6 hippocampus is further amplified by vascular endothelial growth factor (VEGF) signaling. PMID: 25408355
  25. The data indicate that a small genetic variation altered the response to BDNF and show an important role of 5-HT(1A) receptor gene in the 5-HT system response to BDNF treatment and in behavioral effects of BDNF. PMID: 24706292
  26. It plays a pivotal role in the pathophysiology and treatment of psychiatric disorders. PMID: 24942324
  27. Suppression of inflammatory events associated with intestinal ischemia-reperfusion by 5-HT1A blockade in mice PMID: 24548822
  28. The serotoninergic system plays an important role in the regulation of stress-induced depigmentation, which can be mediated by 5-HT1A/1B receptors. PMID: 24586946
  29. When both cholinergic and 5-HT1A receptors are stimulated, fiber outgrowth is restored PMID: 24158140
  30. 5-HT1A receptor activation impaired the acquisition but not the expression of the fear-conditioned HR response suggesting that the underlying neuronal circuits for fear learning differ from those for fear expression. PMID: 23902597
  31. The effects of 5-HT1A autoreceptors on anxiety and social behaviors are developmentally mediated. PMID: 23907404
  32. Data indicate that genetic ablation of RGS6 expression resulted in anxiolytic and antidepressant behavior by enhancing signaling through the 5-HT1A receptor-adenylyl cyclase (AC) axis. PMID: 24421401
  33. Data indicate that the new serotonin 5-HT1A receptor (5-HT1AR) agonist exhibits oral analgesic activity, and suggest a therapeutics for the control of pain. PMID: 24050112
  34. Activation of 5-HT1a receptor had two competing effects: rapid stimulation of breathing due to excitation of respiratory network and inhibition of breathing due to inhibition of 5-HT neurons. PMID: 24381267
  35. Study shows that in the absence of Htr1a hetero-receptor, auto-receptor are unable to have an impact on anxiety. Findings support the hypothesis that Htr1a auto-receptors are necessary, but not sufficient, to modulate anxiety. PMID: 23701504
  36. the antidepressant-like effect of creatine is likely mediated by an interaction with 5-HT1A receptors PMID: 23352985
  37. Data from knockout mice suggest that Htr1a contributes to control of balance between excitation and inhibition of postsynaptic potentials of pyramidal neurons of prefrontal cortex and thus determines orientation of synaptic plasticity. PMID: 23523560
  38. 5-HT(1A)-heteroreceptor-binding sites do not appear developmentally sensitive to reduced brain 5-HT levels PMID: 23692315
  39. Decreased hippocampal 5-HT1A receptor function is induced by mild stress in BDNF-deficient mice. PMID: 22575584
  40. isolation rearing causes hypoalgesia in mouse models of acute pain; spinal 5-HT1A receptor activation, probably through descending serotonergic inhibitory pathway, is involved in isolation rearing-induced hypoalgesia PMID: 23274507
  41. Chronic mild stress modulates Htr1a/2a expression in the cerebellar cortex of atopic-like mice. PMID: 23440396
  42. The 5HT1AR was concentrated to perinuclear vesicular structures in Kif13a-/-neurons. PMID: 23438369
  43. ligand binding densities of the modulatory serotonergic 5-HT1A receptors in the hippocampus and in the primary somatosensory cortex of eAPS mice were significantly upregulated which is suggested to induce the behavioral abnormalities observed. PMID: 22884359
  44. This study demonistrated that Conditional overexpression of the serotonin 1A receptor (Htr1a) in serotonin neurons showed that a chronic reduction in serotonin neuron firing was associated with heightened aggression. PMID: 23678112
  45. serotonin increases outward potassium currents in cultured spiral ganglion neurons through the activation of 5-HT1A receptor PMID: 23531840
  46. this study demonstrate that serotonin, acting through 5-HT1A receptors, plays an excitatory role in forelimb motor map expression. PMID: 23486969
  47. 5-HT(1A) KO mice have a critical period of potential vulnerability at P5 when pups hypoventilate and have a slower respiratory frequency and heart rate with enhanced variability of both, suggesting abnormal maturation of cardiorespiratory control. PMID: 22936722
  48. BDNF produces prolonged ameliorative effect on depressive-like behavior in a genetically predisposed mouse strain. PMID: 22531372
  49. Serotonergic neurons in dorsal raphe nucleus of Htr1a(raphe-overexpressing) mice have dramatically reduced responses to hypercapnic challenge. PMID: 23028768
  50. investigation of role of serotonergic and dopaminergic receptors in cognitive defects in schizophrenia: Response of cognitive defects to nicotine (e.g., to smoking) appears to involve both 5-HT1A serotonin receptor and Dat1 (dopamine transporter 1). PMID: 22809709

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite.
Protein Families
G-protein coupled receptor 1 family, 5-hydroxytryptamine receptor subfamily, HTR1A sub-subfamily
Tissue Specificity
Most abundantly expressed in midbrain, in dorsal raphe and hippocampus. Detected at lower levels in amygdala and brain cortex.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1