Recombinant Mouse Alpha-1A adrenergic receptor (Adra1a)

Code CSB-CF001385MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Adra1a; Adra1c; Alpha-1A adrenergic receptor; Alpha-1A adrenoreceptor; Alpha-1A adrenoceptor; Alpha-1C adrenergic receptor
Species
Mus musculus (Mouse)
Expression Region
1-466
Target Protein Sequence
MVLLSENASEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETICQINE EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN VPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPN FKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL HPPSQAVEGQHRGMVRIPVGSGETFYKISKTDGVREWKFFSSMPQGSARITMPKDQSACT TARVRSKSFLQVCCCVGSSTPRPEENHQVPTIKIHTISLGENGEEV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine (PE)-stimulated ERK signaling in cardiac myocytes.
Gene References into Functions
  1. In the mouse bleomycin model of right ventricular failure, the alpha1A-adrenergic receptor subtype agonist A61603 prevents right ventricular failure. PMID: 28822963
  2. Synergistically acting agonists and antagonists of G protein-coupled receptors prevent photoreceptor cell degeneration PMID: 27460988
  3. Male mouse and marmoset proximal urethral smooth muscle shows strong alpha1A- adrenoceptor-induced contractions and abundant alpha1A-adrenoceptor expression, whereas alpha1A-adrenoceptor-mediated mechanisms are much less important in females. PMID: 28298357
  4. alpha(1)-AR activation is anti-apoptotic and protective during cardiac ischemia due to glucose deprivation and not hypoxia by enhancing glucose uptake into the heart via PKCdelta-mediated GLUT translocation that may be specific to the alpha(1A)-AR subtype. PMID: 26832303
  5. Our results demonstrate the ability of the D-like dopamine receptors to regulate the expression and activity of alphaA-adrenergic receptor PMID: 25339698
  6. Data identify a novel, "inside-out" nuclear a1A-subtype/PKCd/cTnI-signaling pathway that regulates contractile function in adult cardiac myocytes. PMID: 24772522
  7. Male contraception via simultaneous knockout of alpha1A-adrenoceptors and P2X1-purinoceptors in mice. PMID: 24297884
  8. We have provided the first evidence for specific heteromerization between the alpha(1A)-adrenoceptor (alpha(1A)AR) and CXC chemokine receptor 2 (CXCR2) in live cells. PMID: 22371491
  9. Co-localization of the alpha1-subtypes at the nuclei in adult cardiac myocytes facilitated the formation of receptor oligomers that could affect receptor signaling. PMID: 22120526
  10. sustained activation of IL-1 signaling....affects the expression of the ARalpha(1A) subtype..and that modification of adrenergic signaling by the IL-1 system may ultimately cause significant psychiatric abnormalities such as depression PMID: 21722710
  11. Findings uncover a vascular signaling pathway linking alpha(1)-adrenergic receptors and pressure to WNK1, SPAK, and NKCC1 and may, thus, significantly broaden the comprehension of the regulatory mechanisms of vascular tone in arterial hypertension. PMID: 21768522
  12. Activation of the adrenergic receptor alpha 1a subtype enhances learning and memory and has antidepressant and antianxiety effects. PMID: 21791575
  13. result is consistent with coimmunoprecipitation experiments from thoracodorsal resistance arteries, which suggested an association between Pannexin1 and alpha1D-adrenergic receptor PMID: 21546608
  14. the alpha1A-adrenoceptor plays the major role in noradrenaline-induced contraction in ureters PMID: 19259685
  15. Use fluorescent ligand binding to examine Adra1a distribution in arteries. PMID: 20136833
  16. alpha 1A/C-AR subtype is a vasopressor expressed in resistance arteries and is required for normal arterial blood pressure regulation. PMID: 12093905
  17. alpha(1)-ARs in male mice are required for the physiological hypertrophy of normal postnatal cardiac development and for an adaptive response to cardiac stress PMID: 12782680
  18. alpha(1A)- and alpha(1B)-adrenoceptors have roles in myocardial contractions PMID: 14519431
  19. CAM alpha(1A)- and alpha(1B)-ARs both down regulate beta(1)-AR-mediated inotropy in the mouse heart. However, alpha(1)-AR subtypes are coupled to different beta-AR mediated signaling pathways with the alpha(1B)-AR being pertussis toxin sensitive. PMID: 16171811
  20. These results suggest that age-related change in noradrenaline potency is not attributable to the change of drug affinity to alpha(1)-ARs, but is possibly due to drug affinity-unrelated factors such as change of the reserve of alpha(1)-ARs. PMID: 17099296
  21. a direct protective effect of the alpha1A subtype in cardiac myocytes and define an alpha1A-ERK signaling pathway that is required for myocyte survival. PMID: 17283256
  22. These results suggest that lack of both alpha(1A)- and alpha(1B)-ARs could be necessary to inhibit neointimal formation in the mouse femoral artery. PMID: 17384126
  23. Results indicate that in the isolated mouse mesenteric vascular bed, alpha1A-adrenoceptors play an important role in the control of blood pressure. PMID: 17584443
  24. alpha(1)-adrenoceptors, particularly alpha(1A)-adrenoceptors, are required for normal contractility of the vas deferens and consequent sperm ejaculation as well as having a function in fertility PMID: 17603545
  25. We found that application of an alpha(1)-AR agonist produced a long-term depression (LTD) of excitatory transmission in an acute mouse BNST slice preparation. PMID: 18046308
  26. GRK3 controls cardiac alpha1-adrenergic receptor responsiveness PMID: 18165681
  27. These results indicate that DA is a candidate as an endogenous agonist for behaviorally activating LC alpha(1)-receptors and may play a role in the activation of this nucleus by novel surroundings. PMID: 18435418
  28. GATA4 is a survival factor in adult cardiac myocytes but is not required for alpha1A-adrenergic receptor survival signaling. PMID: 18552157
  29. The alpha1A-adrenoceptor gene is required for the alpha1L-adrenoceptor-mediated response in isolated preparations of the mouse prostate. PMID: 18552869
  30. Nuclear alpha1A-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes. PMID: 18802028
  31. Adra1a regulates neurogenesis and gliogenesis in the mouse. PMID: 19487244
  32. These data suggest that alpha(1A)-ARs may be a useful therapeutic target for the treatment of depression. PMID: 19540213
  33. It is hypothesized that the alpha(1)-receptors of the mouse locus coeruleus are strongly activated by 6-fluoronorepinephrine and serve to potently inhibit its tonic or stress-induced activity which in turn disinhibits prepotent motivated behaviors. PMID: 19632210

Show More

Hide All

Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Membrane, caveola.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA1A sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1