Recombinant Mouse B1 bradykinin receptor (Bdkrb1)

Code CSB-CF713962MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Bdkrb1; Bdkrb; B1 bradykinin receptor; B1R; BK-1 receptor
Species
Mus musculus (Mouse)
Expression Region
1-334
Target Protein Sequence
MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVITVCFFGLLGNLLVLSF FLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENVGNRFNWPFGSDLCRVV SGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQVTCLLIWVAGGLLSTPTF LLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPLAAILYFNFHILASLRGQK EASRTRCGGPKDSKTMGLILTLVASFLVCWAPYHFFAFLDFLVQVRVIQDCFWKELTDLG LQLANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.
Gene References into Functions
  1. study revealed that TRPA1 positively modulates the mechanical hyperalgesia induced by B1 receptor activation in the spinal cord and that the classical GPCR downstream molecules PMID: 27823962
  2. Host kinin B1 receptor plays a protective role against melanoma progression. PMID: 26898917
  3. Studied nitric oxide (NO) release, L-arginine (L-Arg) uptake and the expression of the cationic amino acid transporter (CAT) -1 in endothelial cells obtained from B1 receptor knockout (B1-/-) and wild type (WT) mice. PMID: 26446563
  4. Kinin B1R contributes to acute gouty attacks, including the ones facilitated by ACEi. PMID: 25344431
  5. Kinin B1 receptor deletion affects bone healing in type 1 diabetic mice with femoral defects. PMID: 25969420
  6. Kinin B1 receptor deficiency or antagonism diminishes apoptosis caused by cisplatin. PMID: 24357263
  7. investigated if expression of B1 and B2 kinin receptors can be affected by IL-4 and IL-13; data show, for the first time, that IL-4 and IL-13 decrease kinin receptors in a STAT6-dependent mechanism PMID: 23351078
  8. Bradykinin plays an important role in the pathogenesis of anti-collagen antibody-induced arthritis (CAIA). Bradykinin receptor beta 1, whose expression is induced in inflamed joint tissue, is important in the development of CAIA. PMID: 24599920
  9. B(1) receptor deficiency altered plasma oxidant/antioxidant balance and induced moderate left ventricular dysfunction. PMID: 24020815
  10. The kinin B1 receptor plays a significant role in the regulation of skeletal muscle proteolysis in the levator ani muscle atrophy model. PMID: 24498923
  11. Genetic deletion of kinin B1R attenuates cognitive deficits and blocks mRNA expression of IL-17 and IFN-gamma in mice subjected to autoimmune encephalitis. PMID: 23777652
  12. B1R activation plays an important role in limiting the accumulation of amyloid-beta peptides in Alzheimer disease-like brain. PMID: 23470163
  13. Bdkrb1 participates in pathogenesis of LIEP bone loss possibly through mechanisms that involve modulation of TH 17 response, thereby demonstrating its role in the development of periodontitis. PMID: 23534940
  14. Activation of the kinin B1 receptor attenuates melanoma tumor growth and metastasis. PMID: 23691222
  15. B1R and B2R receptors exert a critical role in the establishment of persistent hypersensitivity observed in an experimental autoimmune encephalomyelitis model PMID: 23454198
  16. Lack of kinin B receptor potentiates leptin action in the liver. PMID: 23385644
  17. A loss of B1 receptors markedly exacerbates the severity of dextran sulfate sodium-induced colitis in mice, which may be associated with compensatory overexpression of B2 receptors PMID: 22889120
  18. kinin B(1) receptor participates in the modulation of insulin action in adipocytes, contributing to systemic insulin sensitivity and predisposition to obesity. PMID: 23024762
  19. Data indicate that under normal sodium intake, epithelial Na(+) channel (ENaC) open probability (P(o)) was modestly elevated in bradykinin receptors B1R, B2R(-/-) mice. PMID: 23033373
  20. Data conclude that kinin B1 receptors are important for modulation of insulin secretion and for the preservation of normal glucose levels and hepatic functions in obese mice. PMID: 22829877
  21. In the absence of B2R, both B1R and AT2R play important compensatory roles in preventing deterioration of cardiac function and remodelling post-myocardial infarction. PMID: 22849668
  22. Inflammatory muscle pain involves a cascade of events that is dependent on the activation of PKC, p38 and JNK, and the synthesis of IL-1beta, TNF-alpha and IL-6 associated with the up-regulation of both B(1) and B(2) kinin receptors. PMID: 22220695
  23. B(1) and B(2) receptors play different roles in modulating bradykinin-induced itch-related behavior in complete Freund's adjuvant-inflamed mice. PMID: 22378823
  24. The B(1)R subtype, play a dual role in experimental autoimmune encephalomyelitis progression. PMID: 22132157
  25. Kinin receptor deficient mice (B, or B receptor knock-out and BB receptor, double knock-out) presented a significant reduction in paclitaxel-induced hypernociceptive responses. PMID: 21470206
  26. In knockout mice lacking both B1 and B2 kinin receptors baseline nociceptive responses to heat were unaltered, nocifensive responses to bradykinin are abolished, and acute acetic acid-induced visceral nociception is reduced by approximately 70%. PMID: 22273860
  27. Role of vascular Kinin B1 receptors in endothelial nitric oxide metabolism PMID: 21704095
  28. The treatment of Ehrlich tumor-bearing mice with R-954 during 10 days after tumor inoculation resulted in a significant reduction of ascitic volume which clearly suggested that the B1 receptors were involved in the growth of this invasive tumor. PMID: 21835216
  29. B1 and B2 kinin receptors participate in hyperproliferative and inflammatory skin processes in mice PMID: 21840178
  30. Transplantation of wild-type bone marrow cells into irradiated bradykinin B1 receptor mutant mice restore arteriogenesis, whereas bone marrow chimeric mice show reduced arteriogenesis after femoral artery occlusion. PMID: 21719759
  31. Propose that bradykinin has a crucial role in the pathogenesis of focal and segmental glomerulosclerosis operating through bradykinin B1 receptor signaling. PMID: 21412216
  32. Data show involvement of kinin B1 receptors in depressive behavioral responses, in a process likely associated with microglial activation and TNFalpha production. PMID: 21194425
  33. These results implicate bradykinin acting through bradykinin B1 receptor, in the development of acute lung injury caused by lipopolysaccharide inhalation. PMID: 20153312
  34. Bradykinin and related peptides released from melanoma cells may cause spontaneous pain and allodynia in the melanoma-bearing paw, in which B(1) and B(2) receptors on primary afferent and melanoma cells may have different roles. PMID: 19932979
  35. The volume of the cortical lesions and neuronal damage at 24 h after injury in B1R(-/-) mice were significantly smaller than in wild-type controls (2.5+/-2.6 versus 11.5+/-3.9 mm(3), P<0.001). PMID: 20197781
  36. Complete loss of bradykinin signaling expression does not worsen cardiac function or increase myocardial fibrosis in diabetes. PMID: 20501666
  37. Severe inflammation characterizes rapidly progressive glomerulonephritides, and expression of the kinin B1 receptor (B1R) associates with inflammation. PMID: 20448019
  38. Kinins acting on both B(1) and B(2) receptors played a crucial role in controlling the pruriceptive signalling triggered by PAR-2 activation in mice. PMID: 20067469
  39. all of the detrimental phenotypes observed in Akita diabetes are enhanced by lack of both B1R and B2R, including albuminuria, glomerulosclerosis, mitochondrial DNA deletions, reduction of nerve conduction velocity and heat sensation, and bone mineral loss PMID: 20479236
  40. during the aging process, the B1 receptor could be involved in neurodegeneration and memory loss. PMID: 20060587
  41. Laminar shear stress is a major determinant of functional B1R expression in endothelium. PMID: 19661485
  42. bradykinin b1 receptor mRNA was upregulated up to four-fold 24 h after controlled cortical impact PMID: 19773800
  43. analysis of bradykinin B1 receptors in the mouse kidney PMID: 19581823
  44. Specific B1 receptor activation causes translocation of the epsilon isoform of protein kinase C to the membrane of a small fraction of sensory neurones. PMID: 15319421
  45. involvement of BKB1-R in the development of diabetic hyperalgesia in streptozotocin-mice through activation of the nitric oxide, substance P and calcitonin gene-related peptide pathways PMID: 15654512
  46. Results confirm the crucial role of the bradykinin B1 receptor, upregulated alongside inflammatory diabetes, in the development of diabetes-induced hyperalgesia. PMID: 15680494
  47. Targeted deletion of B1 receptors did not aggravate remodeling after myocardial infarction, whereas blockade of B2 receptors in B1-/- mice exaggerated left ventricular dysfunction and remodeling. PMID: 15699461
  48. the structure was characterized and the molecular mechanism underlying its regulated expression was studied by isolation and analysis of the 5' flanking region PMID: 16006238
  49. The participation of the pro-inflammatory cytokine TNFalpha in the functional up-regulation of B(1) receptors in the mouse paw is reported. PMID: 16039549
  50. Kinin-B1 receptor (kinin-B1R) in cardiac tissue is upregulated in heat stressed mice and downregulated in L-arg-administered mice PMID: 16205319

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB1 sub-subfamily
Tissue Specificity
Expressed in heart, liver and lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1