Recombinant Mouse CD151 antigen (Cd151)

Code CSB-CF004880MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Cd151
Uniprot No.
Alternative Names
Cd151; Peta3; CD151 antigen; GP27; Membrane glycoprotein SFA-1; Platelet-endothelial tetraspan antigen 3; PETA-3; CD antigen CD151
Species
Mus musculus (Mouse)
Expression Region
1-253
Target Protein Sequence
MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLAT AYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNT ELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVV PDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for the proper assembly of the glomerular and tubular basement membranes in kidney.
Gene References into Functions
  1. in complex with P2Y12 receptor contributes to thrombus growth and stability PMID: 26245294
  2. Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation PMID: 26136426
  3. Integrin-associated CD151 represses mammary branching morphogenesis by controlling progenitor cell activities, extracellular matrix integrity and transcription program. PMID: 25486358
  4. Study provide additional evidence that CD151 acts to enhance tumor formation initiated by a range of oncogenes. PMID: 25012362
  5. We identify CD151 as a critical factor in tetradecanoylphorbol acetate-dependent skin carcinogenesis. PMID: 23792458
  6. Loss of CD151 is associated with drug sensitivity in skin squamous cell carcinoma. PMID: 22824799
  7. study provides strong evidence that CD151 collaborates with LB integrins (particularly alpha6beta4 and ErbB2 (and EGFR) receptors to regulate multiple signaling pathways, thereby driving mammary tumor onset, survival, and metastasis PMID: 22952421
  8. CD151 importantly modulates podocyte function. PMID: 22338088
  9. establish CD151 as a crucial modifier of integrin-mediated adhesion of podocytes to the GBM and show that blood pressure is an important factor in the initiation and progression of Cd151 knockout-induced nephropathy PMID: 22201679
  10. CD151 maintains vascular stability by promoting endothelial cell adhesions, especially cell-cell adhesion, and confining cytoskeletal tension. PMID: 21832275
  11. diminished metastasis in CD151-null host animals may be due to impaired tumor-endothelial interactions, with underlying defects in mouse lung endothelial cell extracellular matrix production. PMID: 21536858
  12. CD151 controls Met-dependent neoplastic growth by enhancing receptor signaling through beta4 integrin-mediated pathways, independent of cell-substrate adhesion PMID: 20937830
  13. CD151 may be involved in the interaction of platelets with the subendothelial matrix at sites of vascular damage [review] PMID: 12456024
  14. CD151 plays a key role in selectively strengthening alpha6beta1 integrin-mediated adhesion to laminin-1 PMID: 12805567
  15. CD151-null mice show phenotypes in several different tissue types: a minor abnormality in hemostasis; keratinocytes migrate poorly in skin explant cultures; T lymphocytes are hyperproliferative in response to in vitro mitogenic stimulation. PMID: 15199151
  16. CD151 is essential for normal platelet function and that disruption of CD151 induced a moderate outside-in integrin alpha(IIb)beta(3) signaling defect PMID: 15226180
  17. CD151 plays a key role in strengthening alpha3beta1-mediated adhesion in podocytes. PMID: 17015618
  18. CD151 modulates molecular organization of laminin-binding integrins, thereby supporting secondary (ie, after cell adhesion) functions of endothelial cells, which are needed for some types of pathologic angiogenesis PMID: 17023588
  19. Demonstrate that promoting immobility through a CD151-specific metastasis blocking mAb prevents tumor cell dissemination by inhibiting intravasation without affecting primary tumor growth, tumor cell arrest, extravasation, or growth at the secondary site. PMID: 18328426
  20. Data implicate CD151 as a facilitator of laminin-332-mediated keratinocyte functions that impact on the re-epithelialisation process intrinsic to wound healing and further suggest a potential novel role for CD151 in fibroblast migration. PMID: 18534576
  21. CD151 is a key regulator of MT1-MMP in endothelial homeostasis PMID: 18663148
  22. CD151 appears to be involved in the establishment, maturation, and/or maintenance of the glomerular basement membrane structure in addition to its role in integrin-mediated adhesion strengthening. PMID: 18787104
  23. CD37 and CD151 control DC-mediated T-cell activation by two different mechanisms: CD151 regulates co-stimulation whereas CD37 regulates peptide/MHC presentation PMID: 19089816

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1