Recombinant Mouse CD9 antigen (Cd9)

^{In Stock}

Code	CSB-CF004969MO
Abbreviation	Recombinant Mouse Cd9 protein
MSDS	MSDS Datasheet
Size	$1040
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Cd9

Uniprot No.

P40240

Research Area

Immunology

Alternative Names

Cd9; CD9 antigen; CD antigen CD9

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-226aa

Target Protein Sequence

MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.1 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Our highly reliable and top-quality Recombinant Mouse CD9 antigen is an essential tool for researchers in the field of immunology. CD9, a critical cell surface glycoprotein, plays a pivotal role in various immunological processes. This product is generated using the state-of-the-art in vitro E.coli expression system, ensuring precise and consistent production of the protein.

The Recombinant Mouse CD9 antigen spans the full length of the protein, encompassing amino acids 1 to 226. It is equipped with an N-terminal 10xHis tag, facilitating easy detection and purification of the protein for your experiments. With a purity level exceeding 85% as determined by SDS-PAGE analysis, you can trust the high quality and reliability of this product to yield accurate and reproducible results in your research.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion. In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration. In macrophages, associates with CD9 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption. Acts as a receptor for PSG17. Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Also regulates integrin-dependent migration of macrophages, particularly relevant for inflammatory response in the lung.

Gene References into Functions

The Cd9(-/-) and Cd9(-/-) Cd81(-/-) deletions are associated with a decreased microvilli density on the MII oocyte surface. Microvilli thickness is significantly increased whatever the deleted tetraspanin gene be. Only Cd9 deletion clearly disturbs the vesicular traffic, increasing the number of clathrin and exosome vesicles. PMID: 27879451
CD9 regulates the T cell-stimulatory capacity of granulocyte-macrophage colony-stimulating factor (GM-CSF)-dependent bone marrow-derived Dendritic Cells (BMDCs), without affecting antigen presentation by fms-like tyrosine kinase 3 ligand (Flt3L)-dependent BMDCs. PMID: 28533221
DPP4:CD9:TTSP as the protein complexes are necessary for early efficient MERS-coronavirus entry. PMID: 28759649
Our results indicate that the suppression of cartilage degradation in CD9(-/-) could be in part related to an increase in the expression of the two main cartilage extracellular matrix proteins aggrecan and type II collagen. PMID: 27784871
upregulation may play an important role in podocyte morphology, adhesion, and migration PMID: 25503725
Tetraspanin CD9 and ectonucleotidase CD73 identify an osteochondroprogenitor population with elevated osteogenic properties. PMID: 25564652
Data indicate that anti-inflammatory effects of statins are CD9-dependent. PMID: 24040034
study demonstrates ablation of Cd9 had no detectable effect on de novo primary proatate tumour onset, but did significantly increase metastasis to the liver but not the lungs PMID: 23575960
chemotaxis toward antigen is controlled in mast cells by a cross-talk among FcepsilonRI, tetraspanin CD9, transmembrane adaptor proteins NTAL and LAT, and cytoskeleton-regulatory proteins of the ERM family PMID: 23443658
tetraspanin CD9 modulates molecular organization of integrins in lymphatic endothelial cells, thereby supporting several functions required for lymphangiogenesis PMID: 23223239
Tetraspanin family member CD9 plays an important role in sperm-egg fusion. PMID: 22609062
Results show that SSCs are the most concentrated in CD9(+)EPCAM(low/-) population and also suggest that EPCAM plays an important role in progenitor cell amplification in the mouse spermatogenic system. PMID: 21858196
Our study demonstrated the importance of CD9 in wound re-epithelialization, linking this molecule directly to basement membrane formation and epidermal migration through participating in the regulation of the JNK/MMP-9 pathway. PMID: 21881583
propose that sperm-egg fusion is a direct consequence of CD9 controlled sperm-egg adhesion properties. CD9 generates adhesion sites responsible for the strongest of the observed gamete interaction. PMID: 21690351
knockout mice display abnormal adult angiogenesis PMID: 20592186
This study characterizes CD9 in sperm development and fertilization. PMID: 20428892
Data show that B16F1 lones stably overexpressing CD9 had reduced ability to form colonies in soft agar PMID: 19777564
CD9 is identified as the first receptor for a murine PSG /glycoprotein 17/ PMID: 11805154
role of CD9 in the strengthening of fertilin beta-mediated cell adhesion PMID: 11906941
CD9 may play a role in LIF-mediated maintenance of undifferentiated ES cells. PMID: 11950938
CD9 down-regulation may be a sensitive indicator of macrophage differentiation PMID: 12056820
CD9 inhibits SMC migration by a stimulation of both stress fiber formation and integrin clustering, leading to a stimulation of FAK phosphorylation. PMID: 12083484
the function of CD9 in sperm-egg fusion is was analyzed in CD9-deficient mouse eggs PMID: 12086470
CD9 was enriched in myelinating oligodendrocytes and myelin internodes. Immunoprecipitation of CD9 from postnatal rat cerebrum coprecipitated beta1 integrin, CD81, and Tspan-2. PMID: 12420314
CD9 is found with with the alpha6beta1 integrin heterodimer in parietal endoderm cells , suggesting a role for CD9 in alpha6beta1 mediated migration of parietal endoderm. PMID: 12745436
CD9 is localized to paranodes and has a role in regulating paranodal junctional formation. PMID: 14715942
CD9 is dispensable for B cell development and humoral immunity. PMID: 16116178
During oogenesis the development of the ability of the oolemma to fuse with sperm may be regulated by synthesis of CD9 by the oocyte. PMID: 16719947
Taken together, these results suggest that CD9 expressed on osteoclast lineage cells might positively regulate osteoclastogenesis via the regulation of p44/42 MAPK activity. PMID: 16808899
CD9 expression by multiple myeloma cells is upregulated in vivo by close interaction of the cells with endothelial cells and CD9 is involved in transendothelial invasion PMID: 16900214
CD9 was differentially expressed in uterus depending on the stage of implantation & was upregulated in ovarian steroid hormone-dependent manner, implicating multiple roles of CD9 in regulation of embryo implantation during the peri-implantation period. PMID: 17126340
Oocyte CD9 is enriched on the microvillar membrane and required for normal microvillar shape and distribution. PMID: 17239847
The expression levels of both CD9 mRNA and protein in the frozen oocytes were significantly lower than those found in the fresh oocytes. PMID: 17307168
establish for the first time a role for CD9 in the tumorigenic process PMID: 17582603
The fusion-facilitating activity of CD9-containing vesicles by examining the fusion of sperm to CD9(-/-) eggs with the aid of exogenous CD9-containing vesicles, is investigated. PMID: 18728192
Immunoglobulin superfamily member IgSF8 (EWI-2) and CD9 in fertilisation: evidence of distinct functions for CD9 and a CD9-associated protein in mammalian sperm-egg interaction. PMID: 19210920
macrophage CD9 negatively regulates LPS response at lipid-enriched membrane microdomains PMID: 19414803

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Secreted, extracellular exosome.

Protein Families

Tetraspanin (TM4SF) family

Tissue Specificity

Expressed predominantly in the peripheral nervous system. Highly expressed in oocytes and blastocysts (at protein level). Expression is also observed on follicular oocytes in the ovary, whereas no expression is found on follicular cells (at protein level)

Database Links

KEGG: mmu:12527

STRING: 10090.ENSMUSP00000032492

UniGene: Mm.210676

Promotions