| Code | CSB-MP004969MO |
| Size | |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Target Names | Cd9 |
| Uniprot No. | P40240 |
| Research Area | Immunology |
| Alternative Names | Cd9; CD9 antigen; CD antigen CD9 |
| Species | Mus musculus (Mouse) |
| Source | Mammalian cell |
| Expression Region | 1-226aa |
| Target Protein Sequence | MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Tag Info |
C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it’s possible to develop. |
| Form |
Lyophilized powder Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged. |
| Buffer | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion. In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration. In macrophages, associates with CD9 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption. Acts as a receptor for PSG17. Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Also regulates integrin-dependent migration of macrophages, particularly relevant for inflammatory response in the lung.
|
| Gene References into Functions |
|
| Subcellular Location | Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Secreted, extracellular exosome. |
| Protein Families | Tetraspanin (TM4SF) family |
| Tissue Specificity | Expressed predominantly in the peripheral nervous system. Highly expressed in oocytes and blastocysts (at protein level). Expression is also observed on follicular oocytes in the ovary, whereas no expression is found on follicular cells (at protein level) |
| Database Links |
KEGG: mmu:12527 STRING: 10090.ENSMUSP00000032492 UniGene: Mm.210676 |
