Recombinant Mouse CD9 antigen (Cd9)-VLPs

In Stock
Code CSB-MP004969MO
Abbreviation Recombinant Mouse Cd9 protein-VLPs
MSDS
Size $570
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
The purity information is not available for VLPs proteins.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CD antigen CD9
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-226aa
Target Protein Sequence
MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.6 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion. In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration. In macrophages, associates with CD9 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption. Acts as a receptor for PSG17. Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Also regulates integrin-dependent migration of macrophages, particularly relevant for inflammatory response in the lung.
Gene References into Functions
  1. The Cd9(-/-) and Cd9(-/-) Cd81(-/-) deletions are associated with a decreased microvilli density on the MII oocyte surface. Microvilli thickness is significantly increased whatever the deleted tetraspanin gene be. Only Cd9 deletion clearly disturbs the vesicular traffic, increasing the number of clathrin and exosome vesicles. PMID: 27879451
  2. CD9 regulates the T cell-stimulatory capacity of granulocyte-macrophage colony-stimulating factor (GM-CSF)-dependent bone marrow-derived Dendritic Cells (BMDCs), without affecting antigen presentation by fms-like tyrosine kinase 3 ligand (Flt3L)-dependent BMDCs. PMID: 28533221
  3. DPP4:CD9:TTSP as the protein complexes are necessary for early efficient MERS-coronavirus entry. PMID: 28759649
  4. Our results indicate that the suppression of cartilage degradation in CD9(-/-) could be in part related to an increase in the expression of the two main cartilage extracellular matrix proteins aggrecan and type II collagen. PMID: 27784871
  5. upregulation may play an important role in podocyte morphology, adhesion, and migration PMID: 25503725
  6. Tetraspanin CD9 and ectonucleotidase CD73 identify an osteochondroprogenitor population with elevated osteogenic properties. PMID: 25564652
  7. Data indicate that anti-inflammatory effects of statins are CD9-dependent. PMID: 24040034
  8. study demonstrates ablation of Cd9 had no detectable effect on de novo primary proatate tumour onset, but did significantly increase metastasis to the liver but not the lungs PMID: 23575960
  9. chemotaxis toward antigen is controlled in mast cells by a cross-talk among FcepsilonRI, tetraspanin CD9, transmembrane adaptor proteins NTAL and LAT, and cytoskeleton-regulatory proteins of the ERM family PMID: 23443658
  10. tetraspanin CD9 modulates molecular organization of integrins in lymphatic endothelial cells, thereby supporting several functions required for lymphangiogenesis PMID: 23223239
  11. Tetraspanin family member CD9 plays an important role in sperm-egg fusion. PMID: 22609062
  12. Results show that SSCs are the most concentrated in CD9(+)EPCAM(low/-) population and also suggest that EPCAM plays an important role in progenitor cell amplification in the mouse spermatogenic system. PMID: 21858196
  13. Our study demonstrated the importance of CD9 in wound re-epithelialization, linking this molecule directly to basement membrane formation and epidermal migration through participating in the regulation of the JNK/MMP-9 pathway. PMID: 21881583
  14. propose that sperm-egg fusion is a direct consequence of CD9 controlled sperm-egg adhesion properties. CD9 generates adhesion sites responsible for the strongest of the observed gamete interaction. PMID: 21690351
  15. knockout mice display abnormal adult angiogenesis PMID: 20592186
  16. This study characterizes CD9 in sperm development and fertilization. PMID: 20428892
  17. Data show that B16F1 lones stably overexpressing CD9 had reduced ability to form colonies in soft agar PMID: 19777564
  18. CD9 is identified as the first receptor for a murine PSG /glycoprotein 17/ PMID: 11805154
  19. role of CD9 in the strengthening of fertilin beta-mediated cell adhesion PMID: 11906941
  20. CD9 may play a role in LIF-mediated maintenance of undifferentiated ES cells. PMID: 11950938
  21. CD9 down-regulation may be a sensitive indicator of macrophage differentiation PMID: 12056820
  22. CD9 inhibits SMC migration by a stimulation of both stress fiber formation and integrin clustering, leading to a stimulation of FAK phosphorylation. PMID: 12083484
  23. the function of CD9 in sperm-egg fusion is was analyzed in CD9-deficient mouse eggs PMID: 12086470
  24. CD9 was enriched in myelinating oligodendrocytes and myelin internodes. Immunoprecipitation of CD9 from postnatal rat cerebrum coprecipitated beta1 integrin, CD81, and Tspan-2. PMID: 12420314
  25. CD9 is found with with the alpha6beta1 integrin heterodimer in parietal endoderm cells , suggesting a role for CD9 in alpha6beta1 mediated migration of parietal endoderm. PMID: 12745436
  26. CD9 is localized to paranodes and has a role in regulating paranodal junctional formation. PMID: 14715942
  27. CD9 is dispensable for B cell development and humoral immunity. PMID: 16116178
  28. During oogenesis the development of the ability of the oolemma to fuse with sperm may be regulated by synthesis of CD9 by the oocyte. PMID: 16719947
  29. Taken together, these results suggest that CD9 expressed on osteoclast lineage cells might positively regulate osteoclastogenesis via the regulation of p44/42 MAPK activity. PMID: 16808899
  30. CD9 expression by multiple myeloma cells is upregulated in vivo by close interaction of the cells with endothelial cells and CD9 is involved in transendothelial invasion PMID: 16900214
  31. CD9 was differentially expressed in uterus depending on the stage of implantation & was upregulated in ovarian steroid hormone-dependent manner, implicating multiple roles of CD9 in regulation of embryo implantation during the peri-implantation period. PMID: 17126340
  32. Oocyte CD9 is enriched on the microvillar membrane and required for normal microvillar shape and distribution. PMID: 17239847
  33. The expression levels of both CD9 mRNA and protein in the frozen oocytes were significantly lower than those found in the fresh oocytes. PMID: 17307168
  34. establish for the first time a role for CD9 in the tumorigenic process PMID: 17582603
  35. The fusion-facilitating activity of CD9-containing vesicles by examining the fusion of sperm to CD9(-/-) eggs with the aid of exogenous CD9-containing vesicles, is investigated. PMID: 18728192
  36. Immunoglobulin superfamily member IgSF8 (EWI-2) and CD9 in fertilisation: evidence of distinct functions for CD9 and a CD9-associated protein in mammalian sperm-egg interaction. PMID: 19210920
  37. macrophage CD9 negatively regulates LPS response at lipid-enriched membrane microdomains PMID: 19414803

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Secreted, extracellular exosome.
Protein Families
Tetraspanin (TM4SF) family
Tissue Specificity
Expressed predominantly in the peripheral nervous system. Highly expressed in oocytes and blastocysts (at protein level). Expression is also observed on follicular oocytes in the ovary, whereas no expression is found on follicular cells (at protein level)
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*