Product Details

Target Names

Canx

Uniprot No.

P35564

Alternative Names

Canx; Calnexin

Species

Mus musculus (Mouse)

Expression Region

21-591

Target Protein Sequence

HDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKRDEEEEEEKLEEKQKSDAEEDGVTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins. Associated with partial T-cell antigen receptor complexes that escape the ER of immature thymocytes, it may function as a signaling complex regulating thymocyte maturation. Additionally it may play a role in receptor-mediated endocytosis at the synapse.

Gene References into Functions

CNX has a specific role in cardiomyocyte viability and Ca(2+) cycling through its effects on endoplasmic reticulum stress, apoptosis and Ca(2+) channel expression. PMID: 24037923
Calnexin discriminates between different conformational states of GlyT2 displaying a lectin-independent chaperone activity. PMID: 23650557
calnexin and ERp57, but not calreticulin, play an important role in the biology of peripheral myelin proteins PMP22 and P0, and, consequently, these chaperones may contribute to the pathogenesis of peripheral neuropathies PMID: 21831887
Enhanced clathrin-dependent endocytosis in the absence of calnexin may contribute to the neurological phenotype of calnexin-deficient mice PMID: 21747946
Data show that the E351 mutation led to slightly enhanced ERp57 binding to calnexin, whereas W428 greatly enhanced binding of ERp57 to calnexin. PMID: 20385098
Suggest that Adam7 functions in fertilization through the formation of a complex with heat shock protein 5, calnexin and Itm2b during capacitation in sperm. PMID: 20945367
endoplasmic reticulum stress has effects on group VIA phospholipase A2 in beta cells that include tyrosine phosphorylation and increased association with calnexin PMID: 20732873
Calnexin deficiency leads to dysmyelination PMID: 20400506
Data give novel evidence that CyCAP regulates the post-translational modification of tissue transglutaminase through its colocalization with calnexin in endoplasmic reticulum. PMID: 20049854
Association with mutant peripheral myelin protein-22 ex vivo: a basis for "gain-of-function" ER diseases. PMID: 12119418
Calnexin is required for myelinated motor neuron function and postnatal survival in mice PMID: 12370287
caspase-3 or caspase-7 cleaves calnexin, whose cleaved product leads to the attenuation of apoptosis PMID: 15598898
In mice, a calnexin-glycan interaction may be required to stabilize the weak association of MHC class I heavy chain with beta 2-microglobulin in the endoplasmic reticulum until peptide is bound. PMID: 16002696
UGT1 activity might be required for a structural maturation needed for substrate dissociation from calnexin and export from the ER. PMID: 17643373
Calnexin might stimulate the productive folding of WT CF transmembrane conductance regulator (CFTR), but not DeltaF508 CFTR, which has folding defects. PMID: 18457676
Cnx (-/-) cells have significantly increased proteasomal activity, which may play a role in the adaptive mechanisms addressing the acute endoplasmic reticulum stress observed in the absence of calnexin. PMID: 18528784
Mammalian rod opsin biogenesis does not appear to have an absolute requirement for Cnx. PMID: 19116670
ERp57 does not require interactions with calnexin and calreticulin to promote assembly of class I histocompatibility molecules, and it enhances peptide loading independently of its redox activity PMID: 19196713

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Single-pass type I membrane protein. Endoplasmic reticulum. Melanosome.

Protein Families

Calreticulin family

Database Links

KEGG: mmu:12330

STRING: 10090.ENSMUSP00000020637

UniGene: Mm.248827

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF004485MO
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Calnexin (Canx)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage