Recombinant Mouse Cannabinoid receptor 2 (Cnr2)-VLPs

Code CSB-MP005679MO
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
CB-2; CB2; mCB2
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-347aa
Target Protein Sequence
MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILSSRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLDVRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYALRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.
Gene References into Functions
  1. After occlusion of left pulmonary artery, CB2 receptor seems to modulate right ventricular adaptation through expression of contractile elements, reactive oxygen scavenger enzymes, and inflammatory response in order to prevent cardiomyocyte apoptosis. PMID: 30403990
  2. The blockade of cannabinoid receptor type 2 (CB2) by AM630 during respiratory syncytial virus (RSV) infection enhances the influx of bronchoalveolar lavage (BAL) cells and production of cytokines/ chemokines while exaggerating lung pathology. CB2 activation by JWH133 reduces the influx of BAL cells and production of cytokines/chemokines while alleviating lung pathology. PMID: 28992427
  3. The findings indicate that interaction between CB2R gene and stressors increases the risk of depression-like behaviors that may be linked with neuro-immune crosstalk. PMID: 30042304
  4. Findings support the role of CA1 hippocampal GABAA and CB2 receptors on modulation of memory consolidation. In addition, possible interaction between the hippocampal CB2 receptors and GABAergic interneurons modulate memory consolidation in mice. PMID: 29225001
  5. Results suggest a novel signaling pathway through which CB2 receptors are involved in the analgesic effect of electroacupuncture (EA) on inflammatory pain. These results suggest that EA reduces the inflammatory pain by inhibiting the activation of NLRP3 inflammasome through CB2 receptors PMID: 28782714
  6. Activation of cannabinoid receptor subtype 2 (CB2R) eliminates acetylcholine (ACh)-induced Ca(2+) oscillations and L-arginine-induced enhancement of Ca(2+) signaling in mouse pancreatic acinar cells. PMID: 27432473
  7. Altogether our findings highlight a pro-meiotic role of CB2R in male and female germ cells and suggest that the use of cannabis in pregnant female might represent a risk for fertility and reproductive lifespan in female offspring. PMID: 28981118
  8. CB2Rs in different types of cells in the mature hippocampus play distinct roles in the regulation of memory and anxiety. PMID: 28888955
  9. Evidence has been obtained for CB2 receptor involvement in LPS-induced reduction of cAMP intracellular levels in uterine explants from pregnant mice. PMID: 28460003
  10. CB2 receptor activation in macrophages protects from alcohol-induced steatosis by inhibiting hepatic inflammation through an autophagy-dependent pathway PMID: 27346657
  11. The results of this study suggested that the Cb2 receptor system is rapidly induced during anxiogenic social interactions plus fear conditioning or exercise; with responses potentially adaptive for coping mechanisms. PMID: 28392296
  12. CB2 activation is crucial in regulating pulmonary NK cell function, and suggest that NK cells serve to limit ILC2 group 2 innate lymphoid cell activation and subsequent allergic airway inflammation. PMID: 27992060
  13. Results provide direct pharmacological evidence in vitro and in vivo of a role of CB2R in central glucoregulation. Additionally, it found that glucoregulation by endogenous CB2R signalling is negatively affected by beta-amyloidosis, thought to be the first pathological step in Alzheimer's disease. PMID: 26976670
  14. Deletion of the CB2R has been shown to worsen outcome, while selective CB2R agonists have been demonstrated to be neuroprotective following stroke PMID: 29288767
  15. Describe PM226, a chromenoisoxazole, as a selective CB2 receptor agonist with neuroprotective properties. PMID: 27013280
  16. LRRK2 transgenic mice develop motor impairment and selective activation of CB2 receptor partially reversed the deficits. PMID: 27063942
  17. this study shows that the expression of CB2 receptor in B-lymphocytes is differentially regulated during pregnancy PMID: 27163857
  18. Our data indicate that CB2 may directly contribute to the pathogenesis of eosinophil-driven diseases. Moreover, we provide new insights into the molecular mechanisms underlying the CB2 -mediated priming of eosinophils. PMID: 26850094
  19. CB2 receptor activation prevents degeneration of dopamine neurons in the the substantia nigra of 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine - lesioned mice in vivo - a model of Parkinson's disease. PMID: 27534533
  20. activation of CB2R ameliorates DSS-induced colitis through enhancing autophagy that may inhibit NLRP3 inflammasome activation in macrophages. PMID: 27611972
  21. Data show that (-)-beta-caryophyllene (BCP) diminished axonal demyelination and modulated Th1/Treg immune balance through the activation of cannabinoid receptor type 2 (CB2 receptor). PMID: 28368293
  22. Study demonstrated that the activation of CB2R attenuates the ocular pathology associated with the development and progression of experimental proliferative vitreoretinopathy; intervention at early stage proliferative vitreoretinopathy with CB2R agonists reduces ocular inflammation and disease severity. PMID: 27569993
  23. the M2 macrophage chemokine CCL17 was identified as an essential factor for enhanced survival in the absence of CB2, because CCL17 x Cnr2 double-deficient mice were fully susceptible to experimental cerebral malaria. PMID: 27474745
  24. Cannabigerol is able to counteract oxidative stress by activation of CB2 receptors. CB2 antagonist pre-treatment indeed blocked the protective effects of Cannabigerol in H2O2 stimulated macrophages, while CB1R was not involved. PMID: 28348416
  25. Findings demonstrate that miR-139 exerts a pathogenic effect in Alzheimer's disease by modulating CB2-meditated neuroinflammatory processes. PMID: 28218780
  26. Activation of CB2 ameliorates myocardial fibrosis via Nrf2-mediated inhibition of TGF-beta1/Smad3 pathway in mice with myocardial infarction. PMID: 27614871
  27. This study provides insights into the role of CB2 cannabinoid receptors in regulating cognitive functions such as long-term memory. PMID: 26663094
  28. Behavioral assays revealed that hippocampus-dependent, long-term contextual fear memory was impaired whereas hippocampus-independent, cued fear memory was normal in CB2 receptor knockout mice. These mice also displayed enhanced spatial working memory when tested in a Y-maze. PMID: 26819779
  29. Data indicate that, in the mouse hippocampus, CB2R mRNAs are primarily expressed in a subset of excitatory and inhibitory neurons; amount of CB2R mRNAs in the mouse hippocampus is stable during postnatal development, from age 1 week to adulthood PMID: 26515747
  30. Findings indicate a physiologic role of type 2 cannabinoid receptor (CB2) in regulating the onset of meiosis and in maintaining the homeostasis of spermatogenesis. PMID: 26671998
  31. These results demonstrate a role for CB2 receptors in modulating energy homeostasis and obesity associated metabolic pathologies in the absence of any adverse impact on mood. PMID: 26588700
  32. Study demonstrates the up-regulation of CB2 receptors in glial elements in postmortem tissues of Parkinson's disease patients and an inflammatory mouse model PMID: 25863279
  33. Data shows a BAC transgenic GFP reporter mice retracing the expression pattern of CB2 in spleen B-cells, thymus and microglia. PMID: 26406232
  34. Data suggest that partial ligation of sciatic nerve induces CB2 receptor (Cnr2) expression in ipsilateral spinal cord, but not contralateral cord; oral administration of Cnr2-selective phytocannabinoid exerts analgesic effect in sciatic neuropathy. PMID: 24210682
  35. CB2 receptor expression increased after injury and was associated with high neurological deficit whereas no correlation with edema was found. PMID: 26039099
  36. Data show that HU308 and JWH133 enhanced human and mouse breast cancer cell-induced osteoclastogenesis and exacerbated osteolysis. PMID: 26195631
  37. Results suggest that social environment critically affects the modulatory function of CB2 receptors, especially in alcohol intake PMID: 25827923
  38. This study reveals a novel cellular function of CB2 cannabinoid receptors in the hippocampus and provides insights into how cannabinoid receptor subtypes diversify the roles of cannabinoids in the brain PMID: 25504573
  39. CB2R stimulation dampened post-traumatic inflammation, while deletion of CB2R worsened inflammation. PMID: 25416141
  40. suggest a role for the CB2 in Alzheimer's disease-associated neuroinflammation PMID: 25443294
  41. Deletion of the CB2 r gene increased preference for and vulnerability to ethanol consumption, at least in part, by increased ethanol-induced sensitivity of the TH and mu-opioid receptor gene expressions in mesolimbic neurons. PMID: 23855434
  42. CB2 activation has a favorable inhibitory effect on Ti-induced reactions in MC3T3-E1 cell through modulating proliferation, apoptosis, differentiation, and RANKL expression. PMID: 25292314
  43. NMP-7 inhibits chronic inflammatory and neuropathic pain via block of Cav3.2 T-type calcium channels and activation of CB2 receptors PMID: 25481027
  44. The results of this study demonstrated for the first time that CB2R plays a protective role in EAE through promoting autophagy and inhibiting NLRP3 inflammasome activation. PMID: 25417929
  45. CB2 deletion worsens diabetic nephropathy, independently of bone marrow-derived cells in streptozotocin diabetes. PMID: 24827776
  46. CB2 activation attenuates GalN/LPS-induced ALF by inducing an M1 to M2 shift in macrophages PMID: 25749929
  47. CB2 receptor deficiency increases amyloid pathology and alters tau processing in a transgenic mouse model of Alzheimer's disease PMID: 24722782
  48. CB2Rs are expressed in ventral tegmental area DA neurons and functionally modulate DA neuronal excitability and DA-related behavior. PMID: 25368177
  49. THC slows skeletal elongation of female wild type mice and CB2 deficient mice, but not CB1 deficient animals. PMID: 25573322
  50. Lack of CNR2 was associated with longer intercontraction intervals and higher bladder capacity and compliance than its presence. In WT mice, BC and ICI were increased by CNR2 agonist, and returned to baseline by CNR2 antagonist. PMID: 23908133

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Perikaryon.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed by cells of hematopoietic origin. Expressed in skin in suprabasal layers and hair follicles, in brain by neurons and glial cells and by osteoblasts, osteocytes, osteoclasts (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*