Recombinant Mouse Cannabinoid receptor 2(Cnr2)

Code CSB-CF005679MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P47936
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILS SRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTAS VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCS ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLD VRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYA LRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT
Source in vitro E.coli expression system
Gene Names Cnr2
Protein Names Recommended name: Cannabinoid receptor 2 Short name= CB-2 Short name= CB2 Short name= mCB2
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell projection, dendrite, Perikaryon
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed by cells of hematopoietic origin. Expressed in skin in suprabasal layers and hair follicles, in brain by neurons and glial cells and by osteoblasts, osteocytes, osteoclasts (at protein level).
Database Links

KEGG: mmu:12802

STRING: 10090.ENSMUSP00000069957

UniGene: Mm.297251

Related Products

Cnr2 Proteins

Cnr2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.