Recombinant Mouse Carnitine O-palmitoyltransferase 1, muscle isoform (Cpt1b)

Code CSB-CF856399MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cpt1b; Carnitine O-palmitoyltransferase 1, muscle isoform; CPT1-M; Carnitine O-palmitoyltransferase I, muscle isoform; CPT I; CPTI-M; Carnitine palmitoyltransferase 1B
Species
Mus musculus (Mouse)
Expression Region
1-772
Target Protein Sequence
MAEAHQAVAFQFTVTPDGVDFRLSREALRHIYLSGINSWKKRLIRIKNGILRGVYPGSPT SWLVVVMATVGSNYCKVDISMGLVDCIQRCLPERYGHFGTPQTEALLSMVIFSTGVWATG IFFFRQTLKLLLSYHGWMFEMHSKTSHATKIWAICVRLLSSRRPMLYSFQTSLPKLPVPS VPATIHRYLDSVRPLLDDEAYYRMETLAKEFQDKTAPRLQKYLVLKSWWATNYVSDWWEE YVYLRSRSPLMVNSNYYAMDFVLIKNTNVQAARLGNAVHAMIMYRRKLDREEIKPVMALG MVPMCSYQMERMFNTTRIPGKETDLLQHLSESRHVAVYHKGRFFKVWLYEGSRLLKPRDL EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAEARQTFFSSGKNKMSLDAIERAAFFVT LDEDSHCYNPDDETSLSLYGKALLHGNCYNRWFDKSFTLISCKNGLLGLNTEHSWADAPI IGHLWEFVLGTDTFHLGYTETGHCVGEPNTTLPPPQRLPWDIPEQCREAIENSYQVAKAL ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREG RTETVRSCTNESAAFVQAMMKGSHKKQDLQDLFRKASEKHQNMYRLAMTGAGIDRHLFCL YIVSKYLGVSSPFLAEVLSEPWSLSTSQIPQFQICMFDPKQYPNHLGAGGGFGPVADDGY GVSYMIAGENTMFFHISSKYSSSETNAQRFGNHIRQALLDIAELFKISKTDS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Cpt1b role in the mitochondrial fat oxidation in the lipid induced inffalmation in skeletal muscle. PMID: 27892502
  2. Cardiac CPT-1b suppression protects against the aggravation of cardiac morphology and function associated with HFD feeding. CPT-1b represents a potential therapeutic target for the treatment of cardiac dysfunction related to metabolic diseases such as obesity and diabetes. PMID: 27804274
  3. Data (including data from knockout and chimeric mice) suggest that Cpt1b is involved in myocardial function (but perhaps not in skeletal muscle function); knockout (and presumably inhibition) of Cpt1b results in cardiac hypertrophy and early death. PMID: 24330405
  4. CPT1b deficiency can cause lipotoxicity in the heart under pathological stress, leading to exacerbation of cardiac pathology. PMID: 22932257
  5. Leptin reduces the sensitivity of cardiac CPT-I to malonyl-CoA. PMID: 20056820
  6. Genetic analysis, comparison, and tissue distribution of CPT1b PMID: 12015320
  7. detailed structure of gene 5'-region base sequence and amino acid sequence PMID: 12761301
  8. Cpt1b transcripts are first and temporally detected at the 2-cell stage and reappear at the morula and blastocyst stage PMID: 15237209
  9. Overall, the M-CPTI promoter was found to be necessary for the tissue-specific hormonal and dietary regulation of the gene expression. PMID: 17673163
  10. lethality of homozygous CPT-1b deficiency in the mice is consistent with paucity of human cases. PMID: 18023382
  11. role for brain CPT-1 in the regulation of energy balance PMID: 18056987

Show More

Hide All

Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Protein Families
Carnitine/choline acetyltransferase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1