Recombinant Mouse Cholecystokinin receptor type A (Cckar)

Code CSB-CF004772MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cckar; Cholecystokinin receptor type A; CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R
Species
Mus musculus (Mouse)
Expression Region
1-436
Target Protein Sequence
MDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSAVQILLYSFIFLLSVLGNT LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF MGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS NLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLIPGVVMVVAYGLISLELYQGI KFDASQKKSAKEKRLSSGGGGGGGSSSSRYEDSDGCYLQKSRPPRKLELQQLSTSSSGGR INRIRSSGSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAEKHLSGTPI SFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPTGVRGEVGEEEDGRTIRAS LSRYSYSHMSTSAPPH
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. The studies establish chronic pancreatitis as an IL-33-dependent inflammation resulting from synergistic interactions between the NOD1 and CCKR signaling pathways. PMID: 26813347
  2. There is functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development. PMID: 25875176
  3. mice lacking CCK receptors exhibited a functional shift from the gastrin-CCK pathways to the neuronal pathway in control of the ECL cells and eventually the acid secretion PMID: 25160855
  4. cellular and subcellular localization of cholecystokinin (CCK)-1 receptors in the pancreas, gallbladder, and stomach PMID: 25249350
  5. CCK-8S increases [Ca(2+)]i in gastric antral interstitial cells of Cajal via the CCK(1) receptor PMID: 23326123
  6. CCK1 receptor activation does not have a greater effect combination with upregulated leptin signalling in high-fat-fed mice PMID: 23462797
  7. Suggest role for ependymal CCK-1 receptors in infant satiety-controlling mechanisms. PMID: 23266937
  8. CCK-1 and -2 receptors may function synergistically in single PaPo neurons and deletion of CCK-1 receptors may facilitate CCK-2 receptor signaling. PMID: 23038256
  9. This study demonistrated that cholecystokinin-1 receptor relate to glucose homeostasis. PMID: 21871472
  10. data show that hyperphagia in CCKR/ mice ingesting HF diet is reversed by blockade of the ghrelin receptor. PMID: 21277881
  11. activation of neurons in the nucleus of the solitary tract following administration of T2R agonists to the GI tract involves CCK(1) and Y(2) receptors located on vagal afferent terminals in the gut wall [CCK1R] PMID: 18003792
  12. CCK-A receptor is important for pancreatic exocrine secretion but not essential for maintaining glucose concentration and pancreatic growth in mice PMID: 11893936
  13. Anxiety-related behaviors in cholecystokinin-A, B, and AB receptor gene knockout mice in the plus-maze. PMID: 12459512
  14. Gallstone formation was enhanced in CCK-AR gene knockout mice. PMID: 12572876
  15. Deteriorated gallbladder contraction due to a lack of CCK-AR favored gallstone formation after the middle age of life. PMID: 14627338
  16. Differential roles for cholecystokinin a receptors in energy balance in rats and mice. PMID: 15123537
  17. Mice without CCK-AR showed larger hysteresis than mice with CCK-AR. PMID: 15178543
  18. CCKAR is involved in CCK-8S-induced depolarization of orexin neurons. PMID: 16093397
  19. MEKK1 probably activates a transcriptional partner of c-Jun whose activity is maintained or increased in the presence of the rat cholecystokinin 1 receptor but repressed in the presence of the mouse cholecystokinin 1 receptor. PMID: 16491099
  20. CCK-AR(-/-)BR(-/-) mice showed lower food intake as well as lower response to exogenous ghrelin, and a lower plasma ghrelin level after fasting, though which receptor is more important is unknown. PMID: 17134539
  21. Role for apo A-IV and CCK(1)R in PYY(3-36)-induced activation of vagal afferent pathway and inhibition of gastric emptying, but this is likely not pathway mediating effects of PYY(3-36) on food intake. PMID: 17641001
  22. CCK-AR is an ERalpha downstream gene in the pituitary. CCK-AR may play role in the estrogen sensitization of the pituitary response to GnRH. PMID: 18000302
  23. These results suggest that the CCK(1)R is involved in regulating caloric intake on a meal to meal basis, but that other factors are responsible for regulation of daily food intake. PMID: 18023701
  24. data indicate a novel function of CCK-A receptors in the nonimage-forming photoreception presumably via amacrine cell-mediated signal transduction pathways. PMID: 18073333
  25. Mice lacking CCK1Rs have fewer proliferating cells and neuroblasts than normal and a shortage of interneurons in the OB. PMID: 18305161
  26. CCK-2R is necessary to respond to carbachol as well as to produce the maximal acid secretion, while the role of CCK-1R in acid secretion is less important PMID: 19340558

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1