Recombinant Mouse Claudin-18(Cldn18)

Code CSB-CF005498MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Cldn18
Uniprot No. P56857
Alternative Names Cldn18; Claudin-18
Species Mus musculus (Mouse)
Expression Region 1-264
Target Protein Sequence MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF TECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLT SGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFV GWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVAYRPGGFKASTGFGSNTRN KKIYDGGARTEDDEQSHPTKYDYV
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. The presented data substantiate the hypothesis that claudin-18 is a central barrier-forming component of tight junctions and show that IL-13 downregulates claudin-18. These data also suggest that the loss of claudin-18 is associated with increased sensitization to aeroantigens and airway responsiveness PMID: 27215490
  2. The claudin-18 knockout mice exhibited decreased P2X7 mRNA transcript abundance as measured by mRNA expression microarray PMID: 27663455
  3. CLDN18 deficiency results in epithelial barrier dysfunction, injury, and impaired alveolarization in mice. PMID: 24787463
  4. Identify a role for claudin 18 in alveolar fluid homeostasis beyond its direct contributions to barrier properties. PMID: 24588076
  5. we conclude that the estrogen effects on osteoclasts may in part be mediated via regulation of Cldn-18 signaling PMID: 23299504
  6. Claudin-18 is expressed at the variety of epithelial tissues in inner ear including Organ of Corti, stria vascularis, Reissner's membrane, spiral limbus, vestibular sensory epithelia, and dark cell area. PMID: 14698084
  7. Cldn-18 is a novel negative regulator of bone resorption and osteoclast differentiation PMID: 22437732
  8. Claudin-18 forms a paracellular barrier against H(+) in the stomach. Deficiency causes paracellular H(+) leak, up-regulation of proinflammatory cytokines, recruitment of neutrophils, and atrophic gastritis. PMID: 22079592
  9. Increased expression of claudin-18 is associated with ulcerative colitis. PMID: 18831034

Show More

Hide All

Subcellular Location Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families Claudin family
Tissue Specificity Isoform A1.1: Expressed in lung. Isoform A1.2: Expressed in lung. Isoform A2.1: Expressed in stomach. Isoform A2.2: Expressed in stomach.
Database Links

KEGG: mmu:56492

STRING: 10090.ENSMUSP00000035048

UniGene: Mm.386784

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1