Recombinant Mouse Diacylglycerol kinase epsilon (Dgke)

Code CSB-CF865640MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Dgke
Uniprot No.
Alternative Names
Dgke; Diacylglycerol kinase epsilon; DAG kinase epsilon; Diglyceride kinase epsilon; DGK-epsilon
Species
Mus musculus (Mouse)
Expression Region
1-564
Target Protein Sequence
MEGDQRSGPPAQSLLPDGHLVLWTLCSVLLPVFITLWCSLQRSRRQLHRRDIFRKSKHCW RDTDLFSHPTYCCVCAQHILQGAFCDCCGLRVDEGCLKKVDKRFPCKEIMLKNDKAADAM PHHWIRGNVPLCSYCVFCRQQCGSQPKLCDYRCIWCQKTVHDECMRGSLRSEKCDFGEFR NLIIPPSYLTSINQMRKDKNTNYEGLASKFGKQWTPLIILANSRSGTNMGEGLLGEFKIL LNPVQVFDVTKTPPIKALQLCTLLPYYSVRVLVCGGDGTVGWVLDAIDEMKIKGQEKYIP EVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYYNLR KPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQECKDL NKKIELELDGERVELPNLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEIVGVY GSFHCAQIQVKLANPFRIGQAHTVRLTLKCSMMPMQVDGEPWAQGPCTVTITHKTHALML YFSGEQSDDDISSPSDHEDVKEAE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Membrane-bound diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids. Thereby, acts as a central switch between the signaling pathways activated by these second messengers with different cellular targets and opposite effects in numerous biological processes. Also plays an important role in the biosynthesis of complex lipids. Displays specificity for diacylglycerol substrates with an arachidonoyl acyl chain at the sn-2 position, with the highest activity toward 1-octadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycerol the main diacylglycerol intermediate within the phosphatidylinositol turnover cycle. Can also phosphorylate diacylglycerol substrates with a linoleoyl acyl chain at the sn-2 position but much less efficiently.
Gene References into Functions
  1. DGKepsilon plays a role in glucose and energy homeostasis by modulating lipid metabolism in skeletal muscle PMID: 28246337
  2. Our results unveil an unexpected role of Dgke in the induction of cyclooxygenase-2 and in the regulation of glomerular prostanoids synthesis under stress PMID: 26887830
  3. Inhibition of lipid signaling enzyme diacylglycerol kinase epsilon attenuates mutant huntingtin toxicity. PMID: 22511757
  4. A regulatory role is suggested for DGK epsilon, COX-2, and catecholamine signaling during kindling epileptogenesis. PMID: 16137646
  5. DGKepsilon plays a significant role in determining the enrichment of GPInsP n with 20:4 and that there is a pathway for the selective translocation of arachidonoyl phosphatidic acid from the plasma membrane to the endoplasmic reticulum PMID: 18702510

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm.
Protein Families
Eukaryotic diacylglycerol kinase family
Tissue Specificity
Highly expressed in brain and heart. In brain, highly expressed in Purkinje cells of the cerebellum, pyramidal cells of the hippocampus, mitral cells of the olfactory bulb, and neurons of the substantia nigra. Lower expression in neurons of the thalamus,
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X