Product Details

Target Names

Syvn1

Uniprot No.

Alternative Names

Syvn1; Hrd1; Kiaa1810; E3 ubiquitin-protein ligase synoviolin; RING-type E3 ubiquitin transferase synoviolin; Synovial apoptosis inhibitor 1

Species

Mus musculus (Mouse)

Expression Region

23-612

Target Protein Sequence

YYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLRAAEMEHLLERSW YAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHCRIV SLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAILMTMVLTIFIKYVLHSVDLQSE NPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYLAMRQFKKAVTDA IMSRRAIRNMNTLYPDATPEELQAVDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQR QQTCPTCRMDVLRASLPAQSPPPPEPADQGPPPAPHPQPLLPQPPNFPQGLLPPFPPGMF PLWPPMGPFPPVPPPPSSGEAAAPPPTSTAVSRPSGAATTTAAGTSTSAPAPGSVPGPEA GPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLR NIHTLLDAAMLQINQYLTVLASLGPPRPATSVNPTEETASTVVSAAPSTSAPSSEAPTPS PGASPPIPEAEKPPAPESVGIVEELPEDGEPDAAELRRRRLQKLESPVAH

Protein Length

Full Length of Mature Protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

E3 ubiquitin-protein ligase which accepts ubiquitin specifically from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, promoting their degradation. Component of the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Also promotes the degradation of normal but naturally short-lived proteins such as SGK. Protects cells from ER stress-induced apoptosis. Sequesters p53/TP53 in the cytoplasm and promotes its degradation, thereby negatively regulating its biological function in transcription, cell cycle regulation and apoptosis. Required for embryogenesis. Mediates the ubiquitination and subsequent degradation of cytoplasmic NFE2L1. During the early stage of B cell development, required for degradation of the pre-B cell receptor (pre-BCR) complex, hence supporting further differentiation into mature B cells.

Gene References into Functions

the KAT4 promoter was significantly activated by the transcriptional factors, NFE2related factor 2 and peroxisome proliferatoractivated receptor coactivator 1beta, which are targets of Syvn1induced degradation PMID: 29916549
Hrd1 is a positive regulator of T cells.Hrd1 is required for T-cell activation and differentiation. PMID: 27417417
HRD1 prevents apoptosis in renal tubular epithelial cells by mediating eIF-2a ubiquitylation and degradation. PMID: 29233968
Amyloid beta oligomers modulate BACE1 through an XBP-1-dependent pathway involving HRD1. PMID: 27853315
Hrd1-null B cells exhibited high Fas expression during activation and rapidly underwent Fas-mediated apoptosis, which could be largely inhibited by FasL neutralization. Fas mutation in Hrd1 KO mice abrogated the increase in B-cell AICD. We identified Hrd1 as the first E3 ubiquitin ligase of the death receptor Fas and Hrd1-mediated Fas destruction as a molecular mechanism in regulating B-cell immunity. PMID: 27573825
this study proved that SYVN1 enhances SERPINA1(E342K)/ATZ degradation through SQSTM1-dependent autophagy and attenuates SERPINA1(E342K)/ATZ cytotoxicity. PMID: 28121484
This study implicates Endoplasmic reticulum (ER)-associated degradation mediated by Sel1L-Hrd1 as a key regulator of B cell development. PMID: 27568564
SYVN1 may play an important role in inhibiting ER stress, chronic inflammation, and vascular overgrowth associated with DR. PMID: 26358086
Data show that inositol requiring enzyme 1alpha (IRE1alpha), the sensor of the unfolded protein response (UPR), is a bona fide substrate of the Sel1L proten-Hrd1 protein endoplasmic reticulum (ER)-associated degradation (ERAD) complex. PMID: 26551274
Hrd1 is an essential component of the adaptive endoplasmic reticulum stress response in cardiac myocytes. PMID: 26137860
The results highlight a novel function for SYVN1 in the control of body weight and mitochondrial biogenesis through negative regulation of PGC-1b. PMID: 25698262
Data indicate that E3 ubiquitin-protein ligase Hrd1 catalyzed ubiquitination and degradation of the transcriptional suppressor B lymphocyte-induced maturation protein 1 (BLIMP1) to promote MHC-II antigen expression. PMID: 25366967
oxidative stress-induced HRD1 insolubilization might be involved in a vicious cycle of increased amyloid beta production and amyloid beta-induced oxidative stress in Alzheimer's disease pathogenesis. PMID: 24788773
results indicate that Hrd1 plays an important role in the maturation of collagen I in renal fibrosis, and that Sec23A pathway is required for ER-to-Golgi procollagen trafficking to promote collagen synthesis PMID: 24114659
Synoviolin up-regulates amyloid beta production by targeting a negative regulator of gamma-secretase, Rer1, for degradation. PMID: 23129766
HRD1 is colocated with the neural stem cell marker protein nestin and glial fibrillary acidic protein in the endoplasmic reticulum membrane of the NSCs of the subventricular zone (SVZ astrocytes) but in the cell nucleus of in the dentate gyrus PMID: 22027098
these results clearly suggest that both beta-TrCP- and Hrd1-dependent degradation mechanisms regulate the transcriptional activity of Nrf1 to maintain cellular homeostasis. PMID: 21911472
IL-17 induction of synoviolin may contribute at least in part to RA chronicity by prolonging the survival of RA FLS and immune cells in germinal centre reactions PMID: 20976214
collagen expression in LX-2 cells was upregulated by synoviolin overexpression, while synoviolin knockdown led to reduced collagen expression PMID: 21049091
Synoviolin has an indispensable role in embryogenesis PMID: 15611074
transcriptional regulation of synoviolin via EBS-1 (ETS binding site) plays an important role in cellular homeostasis PMID: 16055742
HRD1 immunoreactivity was detected in the neuronal cells but not in the glial cells of brain. PMID: 18241051
Hrd1 promotes IRE1 ubiquitination and degradation in synovial fibroblasts from mice with collagen-induced arthritis. PMID: 18369366
Synoviolin-mediated ubiquitination is involved in the degradation of immature nicastrin, and probably regulates amyloid beta-protein generation. PMID: 19725872
Review. In addition to its canonical role in endoplasmic-reticulum-associated degradation, synoviolin targets tumor suppressor gene p53 for proteasomal degradation, suggesting crosstalk between ERAD and p53 mediated apoptotic pathway under ER stress. PMID: 17582219

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Protein Families

HRD1 family

Tissue Specificity

Widely expressed, with highest levels in bone, spleen, lung and testis. In the brain, present in neurons but not in glial cells. Up-regulated in synovial tissues from mice with collagen-induced arthritis (at protein level). Expressed in the liver.

Database Links

KEGG: mmu:74126

STRING: 10090.ENSMUSP00000114843

UniGene: Mm.149870

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF875278MO
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse E3 ubiquitin-protein ligase synoviolin (Syvn1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage