Product Details

Target Names

Gpr37l1

Uniprot No.

Q99JG2

Alternative Names

Gpr37l1; Etbrlp2; G-protein coupled receptor 37-like 1; Endothelin B receptor-like protein 2; ETBR-LP-2

Species

Mus musculus (Mouse)

Expression Region

25-481

Target Protein Sequence

AATSSLGGHRAKVQEQQSRPRRGTKDEGPKEVQHYVPEEWAEYPKPIHPAGLQPTKTLEA TSPNPDKDGATPGNGQELRVNLTGTPSQRLQIQNPLYPVTESSYSAYAIMLLALVVFAVG IVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVLFFCLPIVIFNEITKQRLLGDVSCR AVPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVRPIERCQSILAKLAVIWVGSMMLAV PELLLWQLAQEPAPTAGTVDSCIMKPSADLPESVYSLVMTYQNARMWWYFGCYFCLPILF TVTCQLVTWRVRGPPGRKPECRAGRHEQCESQLNSTVVGLTVVYAFCTLPENVCNIVVAY LSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCICRPLGQAFLDCCCCCCCEECGGASD SSATVSADSKLKAEVSSSIYFHKPRESPPLLPLGTPC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

G-protein coupled receptor. Has been shown to bind the neuroprotective and glioprotective factor prosaposin (PSAP), leading to endocytosis followed by an ERK phosphorylation cascade. However, other studies have shown that prosaposin does not increase activity. It has been suggested that GPR37L1 is a constitutively active receptor which signals through the guanine nucleotide-binding protein G(s) subunit alpha. Participates in the regulation of postnatal cerebellar development by modulating the Shh pathway. Regulates baseline blood pressure in females and protects against cardiovascular stress in males. Mediates inhibition of astrocyte glutamate transporters and reduction in neuronal N-methyl-D-aspartate receptor activity.

Gene References into Functions

This study demonstrated that GPR37L1 protects neurons during ischemia, presumably by modulating extracellular glutamate concentration and NMDAR activation. PMID: 28795439
K349N substitution in Gpr37L1 did not grossly alter receptor expression, surface trafficking or constitutive signaling in transfected cells. In vivo studies revealed that a complete loss of Gpr37L1 function in mice results in increased seizure susceptibility. Mice lacking the related receptor Gpr37 also exhibited an increase in seizure susceptibility, while genetic deletion of both receptors resulted greater vulnerability PMID: 28688853
Gpr37l1 participates in the regulation of sonic hedgehog signaling during postnatal cerebellar development. PMID: 24062445

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cell projection, cilium membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Highly expressed in brain but not in heart or kidney (at protein level). In the brain, highly expressed in cerebellar Bergmann glia (at protein level). Detected in the hippocampus but not in the brain stem or neocortex (at protein level). In several key c

Database Links

KEGG: mmu:171469

STRING: 10090.ENSMUSP00000027682

UniGene: Mm.272290

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-CF858741MO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse G-protein coupled receptor 37-like 1 (Gpr37l1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage