Recombinant Mouse G-protein coupled receptor 6(Gpr6)

Code CSB-CF757875MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6YNI2
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MNASAAALNESQVVAVAAEGAAAAATAAGAPDTGEWGPPAASAALGGGGGPNGSLELSSQ LPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADL LAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSR RTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRTSCSVVRPLTRSHVALLSTSFFVVFG IMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYC VVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSP SEV
Source in vitro E.coli expression system
Gene Names Gpr6
Protein Names Recommended name: G-protein coupled receptor 6 Alternative name(s): Sphingosine 1-phosphate receptor GPR6
Expression Region 1-363
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Mainly expressed in the brain. Selectively expressed in striatopallidal neurons in the striatum.
Database Links

KEGG: mmu:140741

STRING: 10090.ENSMUSP00000057323

UniGene: Mm.290693

Related Products

Gpr6 Proteins

Gpr6 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.