Recombinant Mouse G-protein coupled receptor 6(Gpr6)

Code CSB-CF757875MO
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Gpr6
Uniprot No. Q6YNI2
Alternative Names Gpr6; Gm233G-protein coupled receptor 6; Sphingosine 1-phosphate receptor GPR6
Species Mus musculus (Mouse)
Expression Region 1-363
Target Protein Sequence MNASAAALNESQVVAVAAEGAAAAATAAGAPDTGEWGPPAASAALGGGGGPNGSLELSSQ LPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADL LAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSR RTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRTSCSVVRPLTRSHVALLSTSFFVVFG IMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYC VVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSP SEV
Protein Length full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons (By similarity).
Gene References into Functions
  1. Gpr6 deficiency causes an interesting behavioural phenotype in the form of enhanced motor activity combined with reduced abnormal involuntary movements. PMID: 24747358
  2. identification, characterization and cloning; identified sphingosine-1-phosphate as a high-affinity ligand PMID: 14592418
  3. Gpr6 is the first striatopallidal neuron-specific genetic regulator of instrumental conditioning in a mammal. PMID: 17934457
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Mainly expressed in the brain. Selectively expressed in striatopallidal neurons in the striatum.
Database Links

KEGG: mmu:140741

STRING: 10090.ENSMUSP00000057323

UniGene: Mm.290693

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1