Recombinant Mouse Gastrin/cholecystokinin type B receptor (Cckbr)

Code CSB-CF004773MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cckbr; Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R
Species
Mus musculus (Mouse)
Expression Region
1-453
Target Protein Sequence
MDLLKLNRSLQGPGPGSGSSLCRPGVSLLNSSSAGNLSCETPRIRGTGTRELELTIRITL YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVICKAVSYLMGVSVSVSTLNLAAIALERYSAICRPLQARVWQTRSHAARVILATWL LSGLLMVPYPVYTVVQPVGPRILQCMHLWPSERVQQMWSVLLLILLFFIPGVVMAVAYGL ISRELYLGLRFDGDNDSETQSRVRNQGGLPGGAAAPGPVHQNGGCRHVTSLTGEDSDGCY VQLPRSRLEMTTLTTPTTGPGPGPRPNQAKLLAKKRVVRMLLVIVLLFFVCWLPVYSANT WRAFDGPGARRALAGAPISFIHLLSYTSACANPLVYCFMHRRFRQACLDTCARCCPRPPR ARPRPLPDEDPPTPSIASLSRLSYTTISTLGPG
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Our data suggest a progression model for BE to EAC in which CCK2R+ progenitor cells, stimulated by hypergastrinemia, proliferate to give rise to metaplasia and dysplasia. PMID: 27448962
  2. CCKBR and D5R synergistically interact in the kidney, which may contribute to the maintenance of normal sodium balance following an increase in sodium intake PMID: 26751218
  3. findings provide novel evidence that Cnr1 contributes to cued fear expression via an interaction with the CCKB receptor. PMID: 25176168
  4. CCK2R labels +4 antral stem cells that can be activated and expanded by progastrin, thus identifying one hormonal trigger for gastric stem cell interconversion and a potential target for gastric cancer chemoprevention and therapy. PMID: 24951258
  5. cholecystokinin receptor-2 has a role in stress-triggered fear memory and anxiety in the mouse PMID: 21209861
  6. shift of breakpoint on Arrhenius plot established in CCK(2) receptor-deficiency confirms that such kind of alteration in Na(+),K(+)-ATPase temperature dependence is likely related to the homeostatic adjustment of altered function of the sodium pump. PMID: 20058075
  7. Environmental enrichment has beneficial effects in neuropathic conditions and reinforce the causal link between CCK(2) receptors, mechanical sensitivity and the development of CCI-induced hypersensitivity. PMID: 19840831
  8. The gastrin receptor promotes pancreatic growth in transgenic mice. PMID: 11854616
  9. the targeted genetic suppression of cholecystokinin B receptor increased the sensitivity of pre- and post-synaptic dopamine D(2) receptors PMID: 12637032
  10. Na-pump kinetic properties are differently altered in the brain regions of mice deficient in this receptor PMID: 12763910
  11. These results suggest that mice lacking the CCK2 receptor gene are less anxious than normal mice. PMID: 15013032
  12. possibility that the C-terminal tyrosine 438 of the CCK2 receptor associates with the SH2 domains of phospholipase C gamma1 was examined PMID: 15196926
  13. The targeted mutation of CCK(2) receptors selectively antagonised the behavioural changes induced by the individual housing in females, but not in male mice. PMID: 15325774
  14. This study suggests that not only pain sensitivity, but also mechanical sensitivity and the development of neuropathic pain are regulated by antagonistic interactions between CCK and opioid systems. PMID: 15355324
  15. CCK2R expression in pancreas of Elas-CCK2 mice leads to the activation of JAK2 and STAT3 PMID: 15640156
  16. CCK2 receptors have roles in carcinogen-induced preneoplastic lesions formation in murine pancreatic acinar cells PMID: 15688412
  17. CCK(2) receptor deficient mice displayed reduced anxiety compared to their wild-type littermates in the plus-maze test. This behavioural effect seems to be related, at least partly, to an increased tone of opioid system in the brain. PMID: 16488027
  18. Deregulation of the Src/ERK pathway by the CCK2R might represent an early step that contributes to cell proliferation, formation of preneoplastic lesions and pancreatic tumor development. PMID: 16874861
  19. The lack of development of up-regulation of Drd1 and Drd2 genes after repeated treatment with amphetamine probably explains the reduced place conditioning in CCK(2) receptor deficient mice. PMID: 16916582
  20. CCK2 receptor activity plays a contributing regulatory role in the control of food intake. PMID: 17122076
  21. Functional postsynaptic G-protein-coupled CCK B receptors are prevalent in neonatal rodent spinal cord. PMID: 17581850
  22. Gene expression profiling indicates that elements of the immune response are not activated in Cckbr knockout mice following chronic constriction injury. PMID: 18054398
  23. Data show that lacking cholecystokinin B receptors, housed in standard conditions are more anxious, display stronger restraint-induced analgesia and perform worse in the water maze when compared to corresponding wild-type littermates. PMID: 18541314
  24. in juvenile animals when iron demand is high, circulating gastrin concentrations may alter iron status by a CCK2R-independent mechanism. PMID: 18755804
  25. The H(2) receptor and gastrin receptor do not affect emergence of spasmolytic polypeptide (SP/TFF2)-expressing metaplasia (SPEM). The absence of H(2) receptor signaling causes a delay in the maturation of chief cells from mucous neck cells. PMID: 19507031
  26. The results show that social stress increases alcohol intake in low alcohol preference C57BL/10 mice and suggest that CCK transmission may be involved in this effect. PMID: 16205917

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1