Recombinant Mouse Glucose-dependent insulinotropic receptor (Gpr119)

Code CSB-CF766514MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Gpr119; Glucose-dependent insulinotropic receptor; G-protein coupled receptor 119
Species
Mus musculus (Mouse)
Expression Region
1-335
Target Protein Sequence
MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISG LVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGL VAGACIAGLWLVSYLIGFLPLGVSIFQQTTYHGPCSFFAVFHPRFVLTLSCAGFFPAVLL FVFFYCDMLKIASVHSQQIRKMEHAGAMAGAYRPPRSVNDFKAVRTIAVLIGSFTLSWSP FLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLYHMALGVKKF FTSILLLLPARNRGPERTRESAYHIVTISHPELDG
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the endogenous fatty-acid ethanolamide oleoylethanolamide (OEA) and lysophosphatidylcholine (LPC). Functions as a glucose-dependent insulinotropic receptor. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Seems to act through a G(s) mediated pathway.
Gene References into Functions
  1. GPR119 is the oleoyl-lysophosphatidylinositol receptor that is required for GLP-1 secretion in enteroendocrine cells. PMID: 29883799
  2. beta-cell GPR119 expression is dispensable for the physiological control of insulin secretion. PMID: 28254842
  3. we offer evidence for a GPR119-based signaling system in the mammalian eye, with receptors, ligands, and function in the form of a reduction in IOP. Notably this reduction in pressure is restricted to female mice PMID: 28593245
  4. Angelica dahurica extract-treated cells showed significant increases in GPR119 activation, intracellular cAMP levels, GLP-1 levels and glucose-stimulated insulin secretion as compared with controls PMID: 27391814
  5. fat-derived monoacylglycerols are potent candidates for mediating fat-induced GLP-1 release through GPR119 in vivo. PMID: 27297962
  6. GPR119 in L-cells plays a key role in oral lipid-triggered GLP-1 secretion. PMID: 26144594
  7. Data indicate that G-protein coupled receptor 119 (GPR119) knockout prevents the therapeutic effects of Gordonoside F. PMID: 25246581
  8. Describe novel small-molecule GPR119 agonists with high receptor selectivity and capacity to induce glucose-stimulated insulin secretion. PMID: 24681896
  9. Novel GPR119 agonist, HD0471042, effectively controlled glucose levels and prevented weight gain in type 2 diabetic mice. PMID: 23897163
  10. AR231453, a GPR119 agonist, can stimulate beta-cell replication and improve islet graft function PMID: 22099761
  11. Our results demonstrate that combining a GPR119 agonist with a DPP-IV inhibitor may offer a novel therapeutic strategy for stimulating beta-cell regeneration and reversing diabetes. PMID: 23382843
  12. Data suggest that GPR119 activation/up-regulation in skeletal muscle impairs fatty acid and glucose oxidation; diet-induced obesity appears to up-regulate skeletal muscle GPR119. PMID: 23069642
  13. Data suggest that, in lean mice, 2-oleoylglycerol and linoleylethanolamine serve as physiologically relevant endogenous GPR119 agonists that mediate receptor activation upon nutrient uptake. PMID: 23074242
  14. GPR119 engages multiple complementary pathways for control of glucose homeostasis. PMID: 21068156
  15. findings show that N-oleoyldopamine (OLDA)& structurally related hydroxybenzyl amides are robust activators of GPR119; studies indicate that multiple, distinct classes of lipid amides, acting via GPR119, may be important modulators of glucose homeostasis PMID: 19901198
  16. GPR119 therefore represents a novel and attractive potential target for the therapy of obesity and related metabolic disorders. PMID: 16517404
  17. The Gpr119 mRNA levels were elevated in islets of obese hyperglycemic db/db mice as compared to control islets, suggesting a possible involvement of this receptor in the development of obesity and diabetes. PMID: 17070774
  18. AR231453 also enhanced glucose-dependent insulin release in vivo and improved oral glucose tolerance in wild-type mice but not in GPR119-deficient mice. PMID: 17289847
  19. GPR119 regulates glucose tolerance by acting on intestinal endocrine cells as well as pancreatic beta-cells. PMID: 18202141
  20. oleoylethanolamine increases glucagon-like peptide-1 secretion from intestinal L-cells through activation of the novel GPR119 fatty acid derivate receptor in vitro and in vivo. PMID: 19208912
  21. GPR119 is important for incretin and insulin secretion, but not for appetite suppression. PMID: 19282326

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expression restricted to the beta-cells of pancreatic islets.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1