Recombinant Mouse Gonadotropin-releasing hormone receptor (Gnrhr)

Code CSB-CF009637MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Gnrhr; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R
Species
Mus musculus (Mouse)
Expression Region
1-327
Target Protein Sequence
MANNASLEQDPNHCSAINNSIPLIQGKLPTLTVSGKIRVTVTFFLFLLSTAFNASFLLKL QKWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITQPLAVQSNSKLEQSMISLAWILSIVFAGPQLYIFRM IYLADGSGPTVFSQCVTHCSFPQWWHQAFYNFFTFGCLFIIPLLIMLICNAKIIFALTRV LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFATSFVVCWTPYYVLGIWYWFDPEMLNRVS EPVNHFFFLFAFLNPCFDPLIYGYFSL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. leptin's direct stimulatory actions on gonadotrope GnRHR correlate with a direct inhibition of expression of the posttranscriptional regulator MSI1. There also is a direct MSI1 interaction with 3'-UTR of Gnrhr mRNA. PMID: 29228137
  2. the age-dependent basal and regulated Gnrhr transcription could account for the initial blockade and subsequent activation of the reproductive system during development. PMID: 27569529
  3. GnRH-GnRHR system is not essential for growth or motor/sensory/orientation behavior during the first month of life prior to puberty onset. The lack of the GnRH-GnRHR axis, however, did affect females resulting in reduced subcutaneous inguinal fat pad weight and increased glucose with possible insulin resistance. PMID: 28346489
  4. His305 of the GnRH receptor forms two distinct interactions that determine binding to GnRH and couple agonist binding to the conserved transmembrane domain network that activates GPCRs. PMID: 25583361
  5. Data confirm that Gnrhr mRNA and protein are expressed in ovaries, granulosa cells, cumulus cells, and oocytes. PMID: 23913446
  6. Msx1 functions as a negative regulator early in pituitary development by repressing the gonadotrope-specific alphaGSU and GnRHR genes. PMID: 23371388
  7. These results suggest decreased GnRH receptor signaling in the mutant animal, compared with wild type. PMID: 22918878
  8. GnRHR neurons were found in different brain areas. Many GnRHR neurons were identified in areas influencing sexual behaviors PMID: 21303944
  9. A comprehensive knowledgebase of the GnRHR signaling in the LbetaT2 cell, was curated. PMID: 20592162
  10. Null Gnrhr mice had small sexual organs, low levels of FSH, LH, and steroid hormones, failure of sexual maturation, infertility, and inability to respond to exogenous GnRH. PMID: 20068010
  11. GnRH and dex synergistically activate the endogenous GnRHR promoter in L beta T2 cells PMID: 19812390
  12. role of regulatory elements and their cognate transcription factors in transactivation of the mGnRHR gene PMID: 12145309
  13. an intact AP-1 element is necessary for GnRH responsiveness of the GnRHR gene; results suggest a critical role for JNK in mediating GnRH regulation of the GnRHR gene PMID: 12586760
  14. the GnRH receptor activating sequence is a composite regulatory element whose functional activity is dependent on the organization of a multi-protein complex consisting of Smads, AP-1 and a member of the forkhead family of DNA binding proteins PMID: 12943993
  15. Results suggest that pituitary homeobox 1 (Pitx-1) can direct transactivation of the mouse gonadotropin-releasing hormone receptor gene, in part by DNA binding and in part by an action of Pitx-1 as a cofactor for AP-1 [Pitx-1]. PMID: 15226417
  16. NF-Y and Oct-1 bind to the SURG-1 element to direct basal and GnRH-stimulated expression of the mGnRHR gene PMID: 15388790
  17. An autosomal-recessive mutation leucine to proline that causes hypogonadotrophic hypogonadism was isolated during an N-ethyl-N-nitrosourea mutagenesis screen in mice. PMID: 15625238
  18. Regulatory elements defined as the activin/TGFbeta-responsive "enhanceosome" were show in the promoter of the murine GnRHR gene. PMID: 15637149
  19. study demonstrates a functional role for LHX3 in the regulation of the GnRH receptor PMID: 15705775
  20. there are species-specific dominant negative receptor trafficking effects of the GnRHR between human, rat and mouse PMID: 15886197
  21. co-transfection of DAN markedly inhibited the synergistic activation of GnRH and activin on GnRH receptor gene expression thus implicating DAN as a novel autocrine/paracrine factor that modulates GnRH function in pituitary gonadotropes. PMID: 17914181
  22. These data implicate the clock genes as important factors controlling GnRHR expression in murine gonadotrope cells. PMID: 17928134
  23. We have defined the proportion of GnRHRs at the cell surface. PMID: 18252959
  24. NeuroD1 and Mash1 temporally regulate GnRH receptor gene expression in immortalized mouse gonadotrope cells. PMID: 18760324
  25. The two most proximal homeodomain-binding sites in the murine GnRHR promoter may regulate the promoter in a developmentally dependent fashion. PMID: 19333792
  26. Pulsatile and sustained gonadotropin-releasing hormone (GnRH) receptor signaling: does the Ca2+/NFAT signaling pathway decode GnRH pulse frequency PMID: 19858197

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Pituitary gland.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1