Recombinant Mouse Melanin-concentrating hormone receptor 1 (Mchr1)

Code CSB-CF013584MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Mchr1; Gpr24; Slc1; Melanin-concentrating hormone receptor 1; MCH receptor 1; MCH-R1; MCHR-1; G-protein coupled receptor 24; MCH-1R; MCH1R; MCHR; SLC-1; Somatostatin receptor-like protein
Species
Mus musculus (Mouse)
Expression Region
1-423
Target Protein Sequence
MSVGAGKEGVGRAVGLRGSRGCQAVEEDPFLDCGAQAPGQGGGGRWRLPQPAWVDGRALH SREQATCTGCMDLQASLLSTGPNASNISDGQDNFTLAGPPPRTRSVSYINIIMPSVFGTI CLLGIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWH FGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSMATLVICLLWAL SFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVK ILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFV YLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTES KGT
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for melanin-concentrating hormone, coupled to both G proteins that inhibit adenylyl cyclase and G proteins that activate phosphoinositide hydrolysis.
Gene References into Functions
  1. This study demonstrated that the Neurochemical Heterogeneity Among Lateral Hypothalamic Melanin-Concentrating Hormone Neurons. PMID: 28966976
  2. following pups retrieval, MCHR1 knockout mice display a lower level of Fos expression than wild type mice in the ventral tegmental area, and nucleus accumbens PMID: 27617778
  3. This study showed that KO of mchr1 mice had significantly higher levels of both punished and non-punished food maintained responding. PMID: 27633558
  4. MCH1-Rs regulate the rewarding properties of alcohol through interactions with signaling cascades in the nucleus accumbens shell. PMID: 27044354
  5. This study supports the use of the Mchr1-cre mouse for outlining the neuroanatomical distribution and neurochemical phenotype of MCHR1 neurons. PMID: 23605441
  6. This study demonistrated that lack of MCH receptor provoked a ventricular size increase and beat frequency of ependymal cilia. PMID: 23708141
  7. Mchr1 and Sstr3 are expressed and colocalized within cilia in multiple mouse brain regions, and they form heteromers. PMID: 23029470
  8. Disruption of the melanin-concentrating hormone receptor 1 (MCH1R) affects thyroid function PMID: 23024261
  9. The elevated basal body temperature and reduction in NREM sleep time resulting from shorter NREM episode durations observed in knockout mice suggests that central MCH(1) receptor has a role in thermoregulation and presumably stabilization of NREM sleep. PMID: 21074567
  10. Data show that the melanin-concentrating hormone/MCH1R system is one of the players mediating behavioral and metabolic responses upon increased caloric consumption. PMID: 20411353
  11. In melanin-concentrating hormone receptor 1 knock-out mice, long-term synaptic depression was strongly diminished in hippocampus. PMID: 20592115
  12. The data indicate that the MCH system is involved in the regulation of PTZ and pilocarpine seizure threshold. PMID: 20709149
  13. The gene encoding the mouse melanin-concentrating hormone receptor 1 was isolated and its structural organization and flanking regions were characterized. PMID: 15093132
  14. metoprolol completely reversed the tachycardia seen in MCHR1(-/-) mice, suggesting an increased sympathetic tone PMID: 15130877
  15. Periplakin interferes with G protein activation by the melanin-concentrating hormone receptor-1 by binding to the proximal segment of the receptor C-terminal tail PMID: 15590649
  16. In summary, the MCHr is not required for ghrelin induced feeding. PMID: 15607734
  17. Deletion of MCH1r results in an upregulation of mesolimbic dopamine receptors and norepinephrine transporter, indicating that MCH1r may negatively modulate mesolimbic monoamine function. PMID: 15673672
  18. Castration and testosterone treatment on the vasculature in the ventral prostate in adult rats and mice alter expression of this protein. PMID: 15845622
  19. Triple-substitution mutants of intracellular loops 1 and 3 can activate calcium mobilization, albeit with lower efficacy or potency. PMID: 15890773
  20. Pyramidal neurons in knockout mice revealed significantly decreased NMDA responses. PMID: 15926931
  21. These data support the notion that MIZIP might interact with elanin-concentrating hormone receptor 1 (MCHR1) in a cell type specific manner in vivo, suggesting a role in the regulation of MCH signalling in distinct regions of the mammalian brain. PMID: 15950311
  22. show that MCHR1 can modulate stress- and anxiety-like behaviors and suggest that this may be due to changes in serotonergic transmission in forebrain regions PMID: 15988472
  23. MCHR1 may contribute to the neurobiological mechanisms of conditioned cocaine-induced psychomotor effects, possibly to those underpinning sensitization, and to a lesser extent to those sub-serving acute pharmacological cocaine action. PMID: 16839618
  24. the main phenotype displayed by Mchr1 knockout mice was hyperactivity, reduced anxiety, and faster visomotor responses in the absence of nay discernable deficit of sensorimotor and spacial learning abilities PMID: 17270288
  25. MCH1 receptor signalling is involved in the development of fatty liver, as well as obesity, in ovariectomized mice PMID: 17519948
  26. male MCH-1R knockout mice consume more alcohol than wild-type and heterogenous mice PMID: 17550369
  27. Our results do not support the hypothesis of a functional contribution of MCHR1 receptors to the addictive effects of D-amphetamine PMID: 17996928
  28. MCH(1) receptor KO mice are hypersensitive to the behavioral and molecular effects of the dopaminergic psychostimulant d-amphetamine and Increased frontal cortical MAPK phosphorylation and c-fos expression. PMID: 18000809
  29. These results demonstrate that MCH, in addition to its known role in feeding and weight regulation, plays a critical role in regulating Acb dopamine signaling and related behavioral responses. PMID: 18281019
  30. Animals with genetically inactivated melanin-concentrating hormone receptor 1 signaling exhibit altered vigilance state architecture and sleep homeostasis. PMID: 18380672

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed predominantly in the brain. Expression in brain is negatively regulated by leptin. Also found in the epithelium of the tongue and kidney.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1