Recombinant Mouse Melanocyte-stimulating hormone receptor (Mc1r)

Code CSB-CF013558MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Mc1r; Msh-r; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Species
Mus musculus (Mouse)
Expression Region
1-315
Target Protein Sequence
MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIA ITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDV LICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITY YKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAAT LTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRS QELRMTLKEVLLCSW
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Can this be used in SPR assay?

A:

As CSB-CF013558MO is a semi-custom protein currentlly, it can be used in SPR assay. The specific situation depends on the corresponding chip and the corresponding buffer requirements.
Whether MP-VLPs protein is suitable for SPR analysis needs to be known in advance:
1. According to our current experience, VLP protein is not suitable for ligand interaction, because there are other irrelevant host membrane proteins on the VLP envelope, and the ligand interaction will have strong background interference.
2. If it is used in SPR/BLI and other applications, there are certain requirements for the chip and the experimental scheme. ①VLP protein has an envelope, which requires a chip that can bind to vesicles (such as Vesicle Capture (VesCap) chip), but the conventional CM5, NTA and SA chips can't. ② Or, if it adopts the double anti-heart-to-heart strategy, it needs antibodies that recognize two different epitopes of VLP antigen, and one of the antibodies is coated first ( such as CM5 chip), and then binding VLP antigen to test the affinity with another antibody. Of course, it is also possible to adopt an affinity measurement scheme that does not require a chip, such as MST.
As CSB-EP013558MO1 is a semi-custom protein currentlly, it can be used in SPR assay. The specific situation depends on the corresponding chip and the corresponding buffer requirements.

Target Background

Function
Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Mediates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), via regulation of cAMP signaling in melanocytes.
Gene References into Functions
  1. These data clearly show a new and hitherto unsuspected role for MC1R in noncutaneous solid tissues before birth. PMID: 29316344
  2. Collectively, our findings suggest that melanocortin therapy confers a proteinuria reducing and podoprotective effect in proteinuric glomerulopathies via MC1R-independent mechanisms. PMID: 27270328
  3. results highlight a central role for MC1R palmitoylation in pigmentation and protection against melanoma PMID: 28869973
  4. We conclude that MC1R plays an important role in regulating melanoma growth and morphology PMID: 27028866
  5. Activation of Mc1r prevents cholesterol uptake and confers protection against macrophage foam cell formation. PMID: 28450348
  6. MC1-mediated effects were reduced, and MC3 anti-inflammatory circuits predominated. Mice bearing a nonfunctional MC1 displayed a transient exacerbation of neutrophil recruitment after global I/R, which diminished by 2 hours. PMID: 26112010
  7. MR importantly contributes to diabetes-associated vascular dysfunction by inducing oxidative stress and by increasing the activity of redox-sensitive proteins PMID: 25967696
  8. MC1 has an endogenous regulatory function in collagen synthesis and controls the extent of fibrotic stress responses of the skin. PMID: 24698097
  9. A melanin-independent interaction between Mc1r and Met signaling pathways is required for hepatocyte growth factor-dependent melanoma. PMID: 24975581
  10. In summary, we have identified a new alpha-MSH-MC1R physiologic pathway that reduces HO-induced RPE cell damage, and might minimize the risk of developing AMD. PMID: 24316214
  11. Absence of Mc1r does not impair the inflammatory response to UV radiation or the generation of immunosuppression. PMID: 23489427
  12. MC1R decrease the inflammation in vitro and vivo, and might be part of a signaling pathway in inflammatory diseases. PMID: 23090482
  13. Melanocortin receptors 1 and 5 might mediate inhibitory effects of alpha-melanocyte-stimulating hormone on antigen-induced chronic allergic skin inflammation in IgE transgenic mice. PMID: 22437312
  14. MC1R regulates melanoma cell migration via inhibition of syndecan-2 expression. PMID: 22493442
  15. Spatiotemporal localization of MC1R and alpha-MSH in cutaneous wounds warrants future investigation into the role of MC1R/alpha-MSH signaling in the inflammatory and fibroproliferative responses to cutaneous injury. PMID: 21378282
  16. Data show RNA interference that targets Ube3a in P19 cells caused downregulation of Mc1r and Nr4a2, whereas overexpression of Ube3a results in the upregulation of Mc1r and Nr4a2. PMID: 20571502
  17. MC1R contributes to pain of inflammatory origin. PMID: 20856883
  18. MC1R protects by a combination of pigmentary and non-pigmentary effects in vivo and when MC1R function is compromised the melanin type in skin is still protective against UVR PMID: 20237490
  19. The pigmentation of atopic dermatitis is related to increased levels of alpha-MSH, MC1R (in the skin) and MC3R (in intestines). PMID: 19889022
  20. The human receptor efficiently rescued mouse Mc1r deficiency and appeared to be completely resistant to the effect of agouti, suggesting agouti protein may play a role in human pigmentary variation. PMID: 11689486
  21. Antagonist and agonist activities of the mouse agouti protein fragment (91-131) at the melanocortin-1 receptor. PMID: 11693171
  22. the function of the MC1 and MC4 receptors can be positively modulated by metal ions acting both as partial agonists and as potentiators for other agonists PMID: 12244039
  23. the melanocortin-1 receptor (Mc1r) gene mediates kappa-opioid analgesia in female mice only PMID: 12663858
  24. Regulation of melanocortin 1 receptor mRNA and protein levels. PMID: 14500544
  25. there was a significant difference in anesthetic requirements between mice with homozygous melanocortin 1 receptor and control heterozygous mice PMID: 15277941
  26. UV-induced expression of POMC and MC1R is dependent on the p-38-activated upstream stimulating factor-1 PMID: 15358786
  27. The The expression of the Melanocortin Receptor 1 genes in the epidermis and dermis of the dorsal skin was surveyed from 13 d old embryos to 5.5 d old neonates. PMID: 15541020
  28. Melanocortin 1 receptor signaling is regulated by GRK2 and GRK6, which may be important determinants of skin pigmentation. PMID: 15650023
  29. C57BL/6-Mc1r(e/e) mutant mice and human redheads--both with non-functional MC1Rs--display reduced sensitivity to noxious stimuli and increased analgesic responsiveness to the mu-opioid selective morphine metabolite, M6G. PMID: 15994880
  30. ultraviolet light potently induces expression of MSH in keratinocytes, but fails to stimulate pigmentation in the absence of functional MC1R in red/blonde-haired Mc1r(e/e) mice PMID: 16988713
  31. These findings offer insights into the transcriptional nature of the response to ultraviolet rays (UV) in the skin and provide a molecular framework for the mechanisms by which melanocytes and the Mc1r independently afford protection against UV radiation. PMID: 17222061
  32. Results suggest that the Mc1r(e) mutation affects the proliferation and differentiation of melanocytes and l-tyrosine rescues the reduced proliferative and differentiative activities. PMID: 17532540
  33. two genes interact epistatically: the phenotypic effects of Mc1r are visible only in genetic backgrounds containing the derived Agouti allele PMID: 17696646
  34. These data identify the NR4A receptor family as potential mediators of an MC1R-coordinated DNA damage response to ultraviolet rays exposure in melanocytic cells. PMID: 18292087
  35. These findings demonstrate that alpha-MSH suppression of lipopolysaccharide-induced inflammatory activity in macrophages requires expression of MC1r. PMID: 18388300
  36. molecular effects elicited by MC1R ligands that may function during development and may affect skin cancer risk PMID: 19174519

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1