Recombinant Mouse Melatonin receptor type 1A (Mtnr1a)

Code CSB-CF736807MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Mtnr1a; Melatonin receptor type 1A; Mel-1A-R; Mel1a receptor
Species
Mus musculus (Mouse)
Expression Region
1-353
Target Protein Sequence
MKGNVSELLNATQQAPGGGEGGRPRPSWLASTLAFILIFTIVVDILGNLLVILSVYRNKK LRNSGNIFVVSLAVADLVVAVYPYPLVLTSILNNGWNLGYLHCQVSAFLMGLSVIGSIFN ITGIAMNRYCYICHSLKYDKIYSNKNSLCYVFLIWMLTLIAIMPNLQTGTLQYDPRIYSC TFTQSVSSAYTIAVVVFHFIVPMIIVIFCYLRIWVLVLQVRRRVKPDNKPKLKPQDFRNF VTMFVVFVLFAICWAPLNLIGLIVASDPATMVPRIPEWLFVASYYLAYFNSCLNAIIYGL LNQNFRKEYKKIIVSLCTAKMFFVESSNEEADKIKCKPSPLIPNNNLIKVDSV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
High affinity receptor for melatonin. Likely to mediate the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity.
Gene References into Functions
  1. Melatonin MT1 and MT2 receptors interact with dopamine transporter (DAT) in striatum. PMID: 30043140
  2. our data demonstrate that the activation of MT1 signaling at night modulates insulin sensitivity during the day via the regulation of the PI3K transcription and activity PMID: 29247541
  3. knockdown of melatonin receptor leads to interference in the normal physiological function of the ovary by enhancing follicular apoptosis, inhibiting proliferation, and influencing hormonal signaling PMID: 29097083
  4. the present study shows that MT1 receptor deficiency alters the temporal feeding pattern but not the amount of food ingested, and melatonin signaling mediated through the MT1 receptor stimulates Pro-Opiomelanocortin expression in both the ARC and PD of mice. PMID: 27490331
  5. Taken together, these data suggest that melatonin-MT1 receptor complexes represent a potential target for the treatment of glioma. PMID: 29408377
  6. Ecto-5'-nucleotidase mRNA levels were found to be diminished in both MT1 and MT1/2 knockout mice. PMID: 26917036
  7. The removal of MT1R or MT2R in mice abolished the daily rhythm in blood glucose levels, but produced small effects on the rhythmic expression patterns of clock genes within skeletal muscle, liver, and adipose tissue. PMID: 26824606
  8. We have shown that melatonin receptors are expressed in embryonic salivary glands, specifically during salivary gland branching morphogenesis. Melatonin inhibits branching morphogenesis independent of both apoptosis and cell proliferation. PMID: 25876057
  9. MT1 melatonin receptors are involved in neural pathways modulating diurnal rhythms of spontaneous behavior in the homecage as well as pathways regulating depressive and anxiolytic-like behaviors. PMID: 25200199
  10. These data demonstrate that melatonin MT1 receptor knockout mice recapitulate several behavioral and neurobiological circadian changes. PMID: 25638817
  11. The effect of miR-29b on endothelial permeability and apoptosis is mediated through the down-regulation of melatonin receptor 1. PMID: 25131924
  12. there is an an increased proinflammatory status of mice deficient in both membrane-bound melatonin receptors reflected by altered activation of MAPK cascades and transcriptional activation of proinflammatory mediators PMID: 25352055
  13. This study demonistrated that METH-induced CPP is dependent on time of day and the presence of the MT1 receptor, suggesting a role for melatonin in METH-induced reward. PMID: 24813704
  14. Heteromeric MT1/MT2 melatonin receptors modulate photoreceptor function. PMID: 24106342
  15. These data suggest that melatonin, by acting on MT1 receptors, affects NeuroD expression in the gastrointestinal tract and thus might contribute to circadian regulation in metabolic functions. PMID: 23700151
  16. MT1R signaling and BMP-4 actions are mutually augmented, leading to fine-tuning of ACTH production by corticotrope cells. PMID: 23701823
  17. Deletion of the MT1 and MT2 melatonin receptors decreases the development and expression of methamphetamine-induced locomotor sensitization during the light period. PMID: 22672659
  18. Melatonin does not exhibit its potentiation sleeping time in mice through melatonin 3 receptor. PMID: 21166245
  19. molecular behavior of MT1 and MT2 receptor PMID: 22202844
  20. decreased viability of retinal ganglion cells observed in Mtnr1a knock-out mice may be a consequence of increased intraocular pressure. intraocular pressure and melatonin signaling should be considered as risk factors for glaucoma. PMID: 21362461
  21. Immunohistochemical analysis revealed that during tooth development Mel1aR was expressed in secretory ameloblasts, the cells of the stratum intermedium and stellate reticulum, external dental epithelial cells, odontoblasts, and dental sac cells. PMID: 20372918
  22. Investigated the role of the melatonin/melatonin receptor system on clock gene expression using a model of primary neuronal cultures prepared from striatum. PMID: 18798788
  23. MT1 receptor is a major transducer of melatonin's actions in the breast, suppressing mammary gland development and mediating the anticancer actions of melatonin through multiple pathways. PMID: 20050373
  24. Taken together, MT1 receptor signaling may be important for normal brain and behavioral function. PMID: 16459197
  25. MT1 receptor transcripts were localized in photoreceptor cells and in some inner retinal neurons. PMID: 19706469

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×