Recombinant Mouse Muscarinic acetylcholine receptor M1 (Chrm1)

Code CSB-CF005381MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Chrm1; Chrm-1; Muscarinic acetylcholine receptor M1
Species
Mus musculus (Mouse)
Expression Region
1-460
Target Protein Sequence
MNTSVPPAVSPNITVLAPGKGPWQVAFIGSTTGLLSLATVTGNLLVLISIKVNTELKTVN NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV VIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAS CNKAFRDHFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Gene References into Functions
  1. Results indicate that direct inhibition of acetylcholinesterase activity and up-regulation of m1 muscarinic acetylcholine receptor expression in the striatum might contribute to the beneficial effects of alpha-asarone on locomotor hyperactivity in Fmr1 knock out mice. PMID: 27316341
  2. The three receptor sets considered (mAChR, AR and TrkB receptors) intervene in modulating the conditions of the competition between nerve endings. PMID: 27339059
  3. The memory deficits in mouse prion disease were completely restored by treatment with benzyl quinolone carboxylic acid (BQCA) and benzoquinazoline-12 (BQZ-12), two highly selective positive allosteric modulators (PAMs) of M1 mAChRs. Furthermore, prolonged exposure to BQCA markedly extended the lifespan of diseased mice. PMID: 27991860
  4. Data suggest that the inositol phosphate accumulation assay has utility for the evaluation of M1 muscarinic acetylcholine receptor activators in vivo. PMID: 27958713
  5. determining the phosphorylation status of the M1 mAChR at Ser(228) not only provides a means of establishing receptor activation following drug treatment both in vitro and in vivo but also allows for the mapping of the activation status of the M1 mAChR in the hippocampus PMID: 26826123
  6. This study showed that M1 receptor knockout mice have higher noradrenaline levels than that of the wildtype mice, in parallel to a decrease in IgG producing B cells. PMID: 26002586
  7. M1 Muscarinic Receptor Deficiency Attenuates Azoxymethane-Induced Chronic Liver Injury in Mice PMID: 26374068
  8. High M1 muscarinic receptor expression is associated with acute liver injury. PMID: 25452146
  9. This study demonistrated that Expression of m1-type muscarinic acetylcholine receptors by parvalbumin-immunoreactive neurons in the primary visual cortex PMID: 23983014
  10. The mm (chi(1) congruent with -60 degrees ; chi(2) congruent with -60 degrees ) and tp (chi(1) congruent with 180 degrees ; chi(2) congruent with +60 degrees ) rotamers were identified as the likely conduction-catalyzing conformations of the AChR's selectivity-filter glutamates. PMID: 25049389
  11. the M3 receptor has a pro-inflammatory role in cigarette smoke-induced neutrophilia and cytokine release, yet M1 and M2 receptors have an anti-inflammatory role PMID: 23397297
  12. The results of this study suggested that M1-muscarinic receptors promote fear memory consolidation via phospholipase C and the M-current. PMID: 24478341
  13. mAChRs in mouse colonic epithelial cells consist of two subtypes, M1 (80 %) and M3 (20 %); The M1 subtype was likely to regulate epithelial chloride secretion negatively and was susceptible to inflammation PMID: 23242454
  14. M1 receptor is co-localized with VGLUT2 on the intraganglionic laminar endings of esophagus. PMID: 23742744
  15. Downregulation of M1 muscarinic receptor in klotho mutant mice and inactivation of the JAK2/STAT3 signaling axis plays a critical role in cognitive impairment. PMID: 23389690
  16. In the prefrontal cortex, M1 receptor enhances cyclic AMP formation and signaling to the nucleus. PMID: 22456324
  17. Structural rearrangement analysis by FRET revealed that Gq coupling stabilizes the active conformation of muscarinic M1 receptor. PMID: 23085334
  18. M1-mAChRs function at both surface and intracellular sites in telencephalon neurons including the hippocampus PMID: 23678982
  19. a low concentration of N-methyl-d-aspartate causes long-lasting hippocampal cell damage and that endogenous acetylcholine plays, via muscarinic M(1) receptor, a rescuing role in the excitotoxicity-induced long-lasting hippocampal cell damage PMID: 23220711
  20. These data suggest that M1R(-/-) mice display abnormal responding in the face of relatively preserved attention, learning and perception. PMID: 21903112
  21. Data show that CFP/YFP-M(1) mAChR chimera expressed predominantly at the plasma membrane . PMID: 22272263
  22. disrupting the M(1)R plays a role in exacerbating Alzheimer's disease-related cognitive decline and pathological features PMID: 21704011
  23. the P2X7R-Panx1 complex may play an important role as a negative modulator of M1 receptor-mediated seizure activity in vivo PMID: 21505260
  24. We therefore conclude that M1 and M4 receptors are the major mAChR subtypes responsible for direct cholinergic modulation of the excitatory hippocampal circuit. PMID: 21160001
  25. The gating rate and equilibrium constants for receptors with point mutations of alpha-subunit residues located between the binding sites and the membrane domain. PMID: 20682257
  26. The results of this study indicated that the M1 mAChR is an important regulator of amyloidogenesis in the brain and provide strong support for targeting the M1 mAChR as a therapeutic candidate in Alzheimer disease. PMID: 20335454
  27. Muscarinic M1 receptor is so positioned in the cortex as to sense ambient ACh released from cholinergic terminals at variable distances and to enhance the synaptic efficacy and excitability of pyramidal cells. PMID: 20335477
  28. Our data provide important insight into the molecular basis of gamma oscillations by unequivocally establishing a novel role for muscarinic modulation of I(h) and I(cat) in rhythmic network activity. PMID: 11856534
  29. activation on sympathetic postganglionic cells results in catecholamine-mediated cardiac stimulation PMID: 11907166
  30. Just 15% of the M1 receptors in mouse hippocampus was required for maximal binding of oxotremorine-M-stimulated GTP-gamma-35S, suggesting that the M1 receptor is the primary G(alpha)(q)/11-coupled muscarinic receptor in mouse cerebrum. PMID: 12106668
  31. Muscarinic receptors are the predominant receptor mediating contractile responses in female mouse urinary bladder smooth muscle, with strain differences. PMID: 12359634
  32. The presence of muscarinic M1 receptor-mediated relaxation in the stomach fundus supports the neuronal localization of a muscarinic M1 receptor that activates nitric oxide release to effect relaxation. PMID: 12538821
  33. The M1 mAChRs modulate neurotransmitter signaling in cortex and hippocampus. Review. PMID: 12675128
  34. Muscarinic M1 receptors activate phosphoinositide hydrolysis in cortex and hippocampus of mice, consistent with the role of M1 receptors in cognition. Muscarinic M1 receptors appear to be the only muscarinic receptor subtype mediating seizures. PMID: 12713643
  35. RGS2 binds directly to the third intracellular (i3) loop of the G(q/11)-coupled M1 muscarinic cholinergic receptor (M1 mAChR; M1i3). PMID: 14976183
  36. M1 muscarinic receptors selectively modulate CaV1.3 in striatal medium spiny neurons. PMID: 15689540
  37. In gastric chief cells a mixture of M1 and M3 receptors mediates cholinergic stimulation of pepsinogen secretion and no other muscarinic receptor subtypes are involved in this activity PMID: 15933222
  38. KCNQ channel currents in striatal medium spiny neurons were potently reduced by M1 muscarinic receptors. PMID: 16093396
  39. agrin and perlecan cluster with laminin-2 to contribute to assembly of aneural AChR clusters that precede neural agrin release as well as affect later NMJ development PMID: 16219760
  40. Physiologically released acetylcholine from cholinergic fibers modulates hippocampal synaptic plasticity through the postsynaptic M1 mAChR activation. PMID: 16319319
  41. The afterdepolarization in stratum oriens-lacunosum moleculare cells, mediated by M1/M3 receptors, was associated with inhibition of an M current, a slow calcium-activated potassium current, and a calcium-dependent non-selective cationic current PMID: 16322052
  42. Data show that cocaine-induced status epilepticus and lethality produces differential changes in brain muscarinic M(1)and dopaminergic D1 and 2 receptors, depending on the brain area studied. PMID: 16633898
  43. can trigger glandular secretions. PMID: 17192665
  44. Results suggest that M1 and M5 muscarinic cholinergic receptors are not involved in anti-viral immunity. PMID: 17286988
  45. The decreased pituitary-adrenal sensitivity to oxotremorine and restraint stress noted in M(1) knockout mice is consistent with M(1) being primarily a postsynaptic receptor. PMID: 18363805
  46. the decrease in ACh-induced relaxation following perinatal hypoxia, suggesting that M(1)AChR-mediated alteration of ACh-induced relaxation is due to the activation of calcium-dependent PDE1. PMID: 18469116
  47. It is concluded that M1 muscarinic receptors may play a time-dependent role in the consolidation of reward-related memory of morphine. PMID: 18502314
  48. results demonstrate that M1 receptors facilitate cue detection behaviors and are both necessary and sufficient for most direct effects of ACh on pyramidal neuron excitability PMID: 19657040
  49. dysfunction of mAChRs might be a substantial basis for the progressive neurological deterioration in mice with double knockout of GD2 and GD3 synthase. PMID: 19744524

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM1 sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1