Recombinant Mouse Neuromedin-B receptor (Nmbr)

Code CSB-CF015881MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Nmbr; Neuromedin-B receptor; NMB-R; Neuromedin-B-preferring bombesin receptor
Species
Mus musculus (Mouse)
Expression Region
1-390
Target Protein Sequence
MPPRSLSNLSFPTEANESELVPEVWEKDFLPDSDGTTAELVIRCVIPSLYLIIISVGLLG NIMLVKIFLTNSAMRNVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWVFGKLGCKLIP AIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGVLLWTSLKAVGIWVVSVLLAVPEAV FSEVARIGSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLVIISIYYYHIAKTLI KSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFVFCWFPNHVLYLYRSFNYKEIDPSL GHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGRKSYPERSTSYLLSSSAV RMTSLKSNTKNVVTNSVLLNGHSTKQEIAL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for neuromedin-B.
Gene References into Functions
  1. Neuromedin B expression identifies retrotrapezoid nucleus neurons in the mouse. PMID: 29066557
  2. NMB or NMBR silencing inhibited M-CSF/c-Fms-mediated downstream signaling pathways like activation of ERK and Akt and induction of D-type cyclins, cyclin D1 and D2. PMID: 28780306
  3. mice with deletion of NB receptor have lower insulinemia, especially in response to oral glucose, and females also exhibited a better glucose tolerance, suggesting the involvement of neuromedin b and its receptor in regulation of insulin secretion induced by incretins, and also, in insulin sensitivity. PMID: 27756093
  4. ablating NMB receptor-expressing neurons eliminated basal and hypoxia-induced sighing, but left breathing otherwise intact initially PMID: 26855425
  5. The neuromedin B pathways are importantly involved in secretory pathways of TSH and revealed its participation in the in vivo regulation of gene expression of TSH beta-subunit and pituitary MCT8 and Thrb and hypothalamic TRH and type 2 deiodinase. PMID: 25454367
  6. Together, we define the respective function of NMBR and GRPR in itch transmission, and reveal an unexpected relationship not only between the two receptors but also between the two populations of interneurons in itch signaling. PMID: 25209280
  7. spinal GRPr and NMBr independently drive itch neurotransmission in mice. PMID: 23826298
  8. Results implicate that NMB is involved in cartilage development, either in an autocrine or paracrine manner. PMID: 22652580
  9. The mRNA and protein expressions of NMBR reach a peak at the onset of labor. PMID: 19587437
  10. disruption of the neuromedin B receptor pathway did not change body weight homeostasis in female mice fed a normolipid diet PMID: 20211980
  11. NMB-R-deficient mice exhibited decreased behavior in both the L-D box and elevated plus maze tests. PMID: 11803457
  12. 5-HT expression in the dorsal raphe (DR)nucleus is elevated in NMB-R-deficient mice. NMB/NMB-R may modulate 5-HT neuronal activity by affecting DR function. PMID: 12031854
  13. Impaired memory in stressed neuromedin B receptor-deficient mice not consequence of changes in activity, anxiety, or pain response. NMB/NMB-R pathway may have role in regulating stress response via neural system controlling learning and memory. PMID: 12576129
  14. NMBR and BRS-3 genes were expressed from embryonic days 13-16 and on multiple postnatal days for lungs PMID: 12959933
  15. Selectivity of NMBR for neuromedin B over the gastrin-releasing peptide receptor depends primarily on differences in amino acids in the third extracellular domains of the receptors and in the adjacent upper fifth transmembrane region of the two receptors. PMID: 19628633

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1