Recombinant Mouse Neuropeptide FF receptor 2(Npffr2)

Code CSB-CF015983MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q924H0
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MSEKWDSNSSESWNHIWSGNDTQHHWYSDINITYVNYYLHQPQVAAVFISSYLLIFVLCM VGNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKI SGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVTIVIIWGLAIAIMTPSAI MLHVQEEKYYRVRLSSHNKTSTVYWCREDWPRHEMRRIYTTVLFATIYLAPLSLIVIMYA RIGASLFKTAAHCTGKQRPVQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDYTD LSPNKLRIINIYIYPFAHWLAFCNSSVNPIIYGFFNENFRNGFQDAFQICQKKAKPQEAY SLRAKRNIVINTSGLLVQEPVSQNPGGENLGCGKSADNPTQESLIEEMGEATNSTVA
Source in vitro E.coli expression system
Gene Names Npffr2
Protein Names Recommended name: Neuropeptide FF receptor 2 Alternative name(s): G-protein coupled receptor 74 Neuropeptide NPFF receptor
Expression Region 1-417
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. Can also be activated by a variety of naturally occurring or synthetic FMRF-amide like ligands. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:104443

STRING: 10090.ENSMUSP00000040033

UniGene: Mm.447881

Related Products

Npffr2 Proteins

Npffr2 Proteins for Mus musculus (Mouse)

Npffr2 ELISA Kit

Npffr2 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.