Recombinant Mouse Neuropeptide Y receptor type 4(Ppyr1)

Code CSB-CF720235MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Npy4r
Uniprot No. Q61041
Alternative Names Npy4r; Ppyr1; Neuropeptide Y receptor type 4; NPY4-R; NPYR-D; Pancreatic polypeptide receptor 1; PP1
Species Mus musculus (Mouse)
Expression Region 1-375
Target Protein Sequence MNTSHFLAPLFPGSLQGKNGTNPLDSPYNFSDGCQDSAELLAFIITTYSIETILGVLGNL CLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFI QCMSVTVSILSLVLVALERHQLIINPTGWKPSIFQAYLGIVVIWFVSCFLSLPFLANSTL NDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCIPLAFILVCYIRIYQR LQRQKHVFHAHACSSRAGQMKRINSMLMTMVTAFAVLWLPLHVFNTLEDWYQEAIPACHG NLIFLMCHLLAMASTCVNPFIYGFLNINFKKDIKALVLTCHCRSPRGESEHLPLSTVHTD LSKGSMRMGSKSNFI
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PP >> PYY >= NPY.
Gene References into Functions
  1. Genetic deletion of the Y4 receptor impaired fear extinction, an effect that was rescued by short-term fasting PMID: 26062787
  2. Data from studies in knockout mice suggest that signaling through Y4 receptor prevents development of short-/long-term anxiety-/depression-like behaviour caused by acute immune challenge. Study includes comparison with Y2 receptor knockout mice. PMID: 19939871
  3. These findings show that pancreatic polypeptide reduces food intake predominantly via stimulation of the anorexigenic alpha-MSH signaling pathway, and that this effect is mediated by direct action on local Y4 receptors within the arcuate nucleus. PMID: 20041129
  4. fasting inhibits the somatotropic axis via direct action on Y2 receptors in the Arcuate nucleus and indirectly inhibits the gonadotropic axis via Y4 receptors PMID: 17272395
  5. Y4 receptors play an important role in the regulation of behavioral homeostasis PMID: 18221379
  6. The neuropeptide Y (NPY)-Y4 receptor knockout mice Increased novelty-induced motor activity and reduced depression-like behavior. PMID: 19121371

Show More

Hide All

Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Heart, detected in small intestine.
Database Links

KEGG: mmu:19065

STRING: 10090.ENSMUSP00000056576

UniGene: Mm.57059

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1