Recombinant Mouse Opsin-5(Opn5)

Code CSB-CF761518MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6VZZ7
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MALNHTALPQDERLPHYLRDEDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSR RKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWFGCRWYGWAGFFFGCGS LITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAVIWAYASFWTTMPLVGLGDYAPEPFG TSCTLDWWLAQASGGGQVFILSILFFCLLLPTAVIVFSYAKIIAKVKSSSKEVAHFDSRI HSSHVLEVKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAM YNPIIYQVIDYRFACCQAGGLRGTKKKSLEDFRLHTVTAVRKSSAVLEIHPESSSRFTSA HVMDGESHSNDGDCGKK
Source in vitro E.coli expression system
Gene Names Opn5
Protein Names Recommended name: Opsin-5 Alternative name(s): G-protein coupled receptor 136 G-protein coupled receptor PGR12 Neuropsin
Expression Region 1-377
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Detected in the eye, brain and testis.
Database Links

KEGG: mmu:353344

STRING: 10090.ENSMUSP00000063542

UniGene: Mm.184937

Related Products

Opn5 Proteins

Opn5 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.