Recombinant Mouse P2Y purinoceptor 2 (P2ry2)

Code CSB-CF017334MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
P2ry2; P2ru1; P2Y purinoceptor 2; P2Y2; ATP receptor; P2U purinoceptor 1; P2U1; Purinergic receptor
Species
Mus musculus (Mouse)
Expression Region
1-373
Target Protein Sequence
MAADLEPWNSTINGTWEGDELGYKCRFNEDFKYVLLPVSYGVVCVLGLCLNVVALYIFLC RLKTWNASTTYMFHLAVSDSLYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTR ITCHDTSARELFSHFVAYSSVMLGLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAK RKSVRTIALVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTEPTPSPQARRKLGLHRPNRTVRKDLSVSSDDSRRTE STPAGSETKDIRL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ATP and UTP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system. The affinity range is UTP = ATP > ATP-gamma-S >> 2-methylthio-ATP = ADP.
Gene References into Functions
  1. The P2Y2R enhances Ubiquitin-Proteasome System activity by increasing the subunits expression beta 5 and beta 1. PMID: 27768902
  2. The results of this study suggest that P2Y2Rs contribute to the development of salivary gland inflammation in IL-14alphaTG mice and may also contribute to autoimmune sialadenitis in humans. PMID: 29297959
  3. Our results clearly demonstrate the involvement of P2Y2R subtypes in the pathogenesis of fibrotic lung diseases in humans and mice and hence support the development of selective P2Y2R antagonists for the treatment of IPF. PMID: 28415591
  4. knockdown of P2Y2R retarded cyst expansion in vitro and prevented ATP- and HIF-1alpha-dependent cyst growth. In conclusion, P2Y2R mediates ATP-dependent cyst growth and is transcriptionally regulated by HIF-1alpha. PMID: 27565965
  5. P2Y2R is an inhibitor of arterial intimal calcification, regulating the osteoblastic trans-differentiation of smooth muscle cells through P2Y2R-mediated Runx2 antagonism. PMID: 28038380
  6. These findings are consistent with the notion that the primary action of P2Y2 receptor signalling in bone is to regulate extracellular ATP levels. PMID: 28420708
  7. Results demonstrate that P2Y2 contributes to response properties of cutaneous afferents, as P2Y2 deletion reduces responsiveness of conventional unmyelinated polymodal afferents to heat and appears to result in the acquisition of mechanical responsiveness in a subset of TRPV1-expressing afferents. PMID: 27393251
  8. This study suggests that P2Y2 may participate in cardiomyopathy in mdx mice. PMID: 27220808
  9. Extracellular ATP induces vascular inflammation and atherosclerosis via activation of P2Y2. PMID: 27339459
  10. Endothelial cell-specific P2Y2R deficiency reduces atherosclerotic burden and promotes plaque stability in ApoE(-/-) mice through impaired macrophage infiltration acting together with reduced matrix metalloproteinase-2 activity and increased smooth muscle cell migration. PMID: 27856454
  11. Calcium-mediated purinergic receptors regulate the migration and phagocytic ability of microglia during post-natal brain development. PMID: 25575683
  12. expression of P2Y(2) receptor in peripheral sensory neurons that innervate the injured tissue and the activation of P2Y receptors contributes to mechanical allodynia following inflammation PMID: 26062804
  13. In P2Y1R (-/-) mice, the expression of P2Y2 receptor in muscle was reduced by over 50 %, as compared to P2Y1R (+/+) mice. PMID: 26036470
  14. gene deficiency restricted to hematopoietic tissues results in longer survivak after GvHD PMID: 26538394
  15. P2Y2R deficiency does not alter baseline collateral vessel formation but does significantly impair collateral maturation, with resultant persistent limb ischemia despite enhanced angiogenesis. PMID: 25088742
  16. P2Y2-/- mice are less susceptible to mount an autoimmune response against IRBP PMID: 25692550
  17. P2Y2 and Gq/G11 are required for basal endothelial NO formation, vascular tone, and blood pressure. PMID: 26168216
  18. P2Y2-mediated increase of cytoplasmic Ca(2+) concentration down-regulates the expression of NCC. PMID: 24463702
  19. P2Y2 receptors play important roles in bone marrow cell differentiation and mineralization as well as in bone cell mechanotransduction, leading to an osteopenic phenotype in P2Y2 knockout mice. PMID: 25268784
  20. P2Y2R has a role in the skin wound-healing process in mouse models PMID: 24816122
  21. Thus, P2Y2R activation protects cardiomyocytes from hypoxia in vitro and reduces post-ischemic myocardial damage in vivo. PMID: 23828651
  22. UTP-induced migratory responses required for salivary gland acinar cell self-organization are mediated by the P2Y2R. PMID: 24760984
  23. Osteoblasts can regulate their mechanosensitivity through P2Y2R activation leading to increased cell stiffness. PMID: 24696143
  24. Mice deficient in P2Y2 or lacking ATP secretion from platelets show strongly reduced tumor cell metastasis PMID: 23810565
  25. up-regulation of P2Y2Rs in primary cortical neurons under pro-inflammatory conditions can promote cofilin-dependent neurite outgrowth, a neuroprotective response that may be a novel pharmacological target in the treatment of neurodegenerative diseases. PMID: 23550835
  26. Stimulation of astrocytic P2Y1R receptors significantly reduces brain injury after acute trauma and is mediated by the inositol 1,4,5-trisphosphate (IP3) receptor-signaling pathway. PMID: 23046422
  27. Purinergic P2Y receptors promote neutrophil infiltration and hepatocyte death in mice with acute liver injury. PMID: 22974709
  28. Although C/EBPbeta was sufficient to induce P2Y(2) transcription, the effect of C/EBPbeta and NF-kappaB p65 on receptor transcription was synergistic. PMID: 22742194
  29. Real-time imaging reveals that P2Y2 and P2Y12 receptor agonists are not chemoattractants and macrophage chemotaxis to complement C5a is phosphatidylinositol 3-kinase (PI3K)- and p38 mitogen-activated protein kinase (MAPK)-independent. PMID: 22199395
  30. P2Y2 and P2Y12 receptor agonists are not chemoattractants and macrophage chemotaxis to complement C5a is phosphatidylinositol 3-kinase (PI3K)- and p38 mitogen-activated protein kinase (MAPK)-independent. PMID: 22057273
  31. genetic deletion of P2Y2-R offers significant resistance to the development of Li-induced polyuria, without altering blood Li levels and renal accumulation of Li, and suppression of PGE2 production PMID: 21975874
  32. These results indicate that the P2Y(2) receptor mediates uridine-5'-triphosphate cardioprotection, in vivo. PMID: 21839729
  33. Systemic activation of P2Y(2) receptors lowers blood pressure and inhibits renal sodium reabsorption. PMID: 21613580
  34. role in chondrocyte mechanotransduction PMID: 21520257
  35. Data show that tlt and mlh mutations uncouple Otopetrin 1 from inhibition of P2Y receptor function. PMID: 21236346
  36. Heterologous down-regulation of angiotensin type 1 receptors by purinergic P2Y2 receptor stimulation through S-nitrosylation of NF-kappaB. PMID: 21464294
  37. P2Y(2) R appears to be involved in asthmatic airway inflammation PMID: 20880147
  38. Data show that autocrine purinergic receptor P2Y(2), or P2Y(12) signaling amplifies and translates chemotactic cues into directional motility. PMID: 20664064
  39. Control of ENaC by purinergic signaling (P2Y2) is necessary for aldosterone escape. PMID: 20813869
  40. Eosinophil accumulation, a distinctive feature of lung allergic inflammation, is defective in ovalbumin (OVA)-treated P2Y2 receptor-deficient mice compared with OVA-treated wild type animals. PMID: 20720203
  41. Neutralizing intrapulmonary ATP levels or blocking airway P2Y2 receptors on lung neutrophils and macrophages inhibits smoke-induced lung inflammation and confers protection from the development of emphysema. PMID: 20519655
  42. These results support involvement of P2Y(2) receptors in bladder sensation, suggesting an important contribution to bladder neuron excitability and hypersensitivity. PMID: 20147562
  43. study shows that P2Y2 receptors are expressed in cumulus cell-enclosed oocytes, and that their stimulation opens at least two different types of ion channels PMID: 12193392
  44. Knock-out mice reveal tissue-specific roles of P2Y receptor subtypes in different epithelia. PMID: 12644577
  45. Both the P2Y2 and P2Y4 receptors are present in the luminal membrane of mouse distal colonic mucosa, and stimulation of these receptors leads to potassium ion secretion. PMID: 15718265
  46. functional interaction between endogenous P2Y2 receptor and TRPV1 channels could explain the ATP-induced pain PMID: 16133936
  47. P2Y(2) has a role as a morphogen receptor that potentiates neurotrophin signaling in neuronal development and regeneration PMID: 16365320
  48. The role of P2Y2 and P2Y4 receptors in peritoneal macrophage calcium signaling is reported. PMID: 16980298
  49. I(Cl.UTP) is due to the activation of CFTR Cl- channels through Gq/11-coupled P2Y2 receptor-PLC-PKC signaling and ATP hydrolysis in mouse heart PMID: 17291397
  50. oncogenic potential of P2RY2 was confirmed in vitro with the focus formation assay as well as soft agar-growth assay, and also in vivo with a tumorigenicity assay in nude mice. PMID: 17382903

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Spleen, testis, kidney, liver, lung, heart and brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1