Recombinant Mouse P2Y purinoceptor 6 (P2ry6)

Code CSB-CF866832MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
P2ry6
Uniprot No.
Alternative Names
P2ry6; P2Y purinoceptor 6; P2Y6
Species
Mus musculus (Mouse)
Expression Region
1-328
Target Protein Sequence
MEQDNGTIQAPGLPPTTCVYREDFKRLLLTPVYSVVLVVGLPLNICVIAQICASRRTLTR SAVYTLNLALADLMYACSLPLLIYNYARGDHWPFGDLACRFVRFLFYANLHGSILFLTCI SFQRYLGICHPLASWHKRGGRRAAWVVCGVVWLAVTAQCLPTAVFAATGIQRNRTVCYDL SPPILSTRYLPYGMALTVIGFLLPFIALLACYCRMARRLCRQDGPAGPVAQERRSKAARM AVVVAAVFAISFLPFHITKTAYLAVRSTPGVSCPVLETFAAAYKGTRPFASVNSVLDPIL FYFTQQKFRRQPHDLLQRLTAKWQRQRV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for extracellular UTP > ADP = 2-methylthio-ATP > ADP-beta-S > ATP = ATP-gamma-S. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Functionally coupled to phospholipase C.
Gene References into Functions
  1. Prostaglandin E2 glyceryl ester is an endogenous agonist of the nucleotide receptor P2Y6. PMID: 28539604
  2. Results demonstrated that P2Y6 signaled through Ca(2+) influx and RhoA/ROCK to reorganize cytoskeleton and promote migration in myoblasts. PMID: 28815725
  3. the P2Y6 receptor in the central nervous system, dorsal root ganglion, or both is involved in inhibition of bladder afferent signalling or sensitivity in the pontine micturition centre and that the receptor in the detrusor may be implicated in facilitation to sustain bladder contraction force. PMID: 28396595
  4. The present study shows that sustained activation of P2Y6R may contribute to intestinal tumorigenesis by blocking the apoptotic process and by contributing to chemoresistance, a substantial concern in the treatment of patients with CRC. PMID: 29454075
  5. P2Y6 contributes to allergic airway inflammation and remodeling by enhancing the functions of mast cells in ovalbumin-induced asthmatic mice PMID: 27590515
  6. these findings suggest that the P2Y6 receptor plays a critical role in mediating microglial phagocytosis in radiation-induced brain injury. PMID: 26099306
  7. P2Y6 UDP receptor, the most expressed P2Y receptor in mouse resistance arteries, is required for maintaining proper arterial tone. PMID: 27255725
  8. The present study identifies mouse P2Y6 receptor as a regulator of cardiac development and cardiomyocyte function. P2Y6 receptor could constitute a therapeutic target to regulate cardiac hypertrophy. PMID: 27231349
  9. These results suggest that increased formation of AT1R-P2Y6R heterodimers with age may increase the likelihood of hypertension induced by Ang II. PMID: 26787451
  10. Study demonstrates that AgRP neurons express the purinergic receptor 6 (P2Y6), which is activated by uridine-diphosphate (UDP). In vivo, UDP induces ERK phosphorylation and cFos expression in AgRP neurons and promotes action potential firing of these neurons in brain slice recordings. PMID: 26359991
  11. P2Y(6) receptor augments pro-inflammatory responses in macrophages PMID: 25360548
  12. The results demonstrate the important role of P2Y6 as a danger signal in antiviral immune responses. PMID: 25261483
  13. these data outline a novel role for the P2Y6 receptor in the induction of CXCL8/IL-8 production and barrier dysfunction in response to C. difficile toxin exposure and may provide a new therapeutic target for the treatment of CDI. PMID: 24278446
  14. P2Y6 deficiency limits atherosclerosis and plaque inflammation in mice. PMID: 25104800
  15. P2Y(6) receptor signaling pathway may be a potential therapeutic target for MSU-associated inflammatory diseases, such as tophaceous gout. PMID: 22102722
  16. P2Y(6) receptor may play an important role in the regulation of bone cell function in vivo. PMID: 21828185
  17. P2Y6 receptors protect the lung against exuberant allergen-induced pulmonary inflammation by inhibiting the activation of effector T cells. PMID: 21724990
  18. our studies demonstrate that P2Y(6) receptor could be a novel mediator in upregulating innate immune response against the invaded pathogens through recruiting monocytes/macrophages PMID: 21444765
  19. important contribution of P2Y(6) signaling in enhancing vascular inflammation during systemic LPS challenge PMID: 21173118
  20. Purinergic receptors might represent important new set of molecular targets for theca hyperplasia and polycystic ovarian syndrome. PMID: 20630102
  21. Involvement of nucleotide receptors, particularly P2Y(6) receptors, during atherosclerosis is suggested. PMID: 20050854
  22. Inflammation up-regulates P2Y2 as well as P2Y6 receptor expression in the colonic mucosa of colitic mice. PMID: 18250478
  23. P2Y(6)-deficient mice have a defective response to UDP in macrophages, endothelial cells, and vascular smooth muscle cells. PMID: 18523137
  24. Mouse bone marrow-derived mast cells express uridine diphosphate-selective P2Y6 receptors that cooperate with type 1 cysteinyl-leukotriene receptors to promote cell survival and chemokine generation by a reciprocal ligand-mediated cross-talking pathway. PMID: 19124756
  25. the results indicate that activation of P2Y6 and P2X7 receptors contributes to T cell activation via TCR. PMID: 19426712

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1