Recombinant Mouse Parathyroid hormone/parathyroid hormone-related peptide receptor (Pth1r)

Code CSB-CF018988MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Pth1r
Uniprot No.
Alternative Names
Pth1r; Pthr; Pthr1; Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor; PTH/PTHr receptor; Parathyroid hormone 1 receptor; PTH1 receptor
Species
Mus musculus (Mouse)
Expression Region
27-591
Target Protein Sequence
DADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAANIMESDKGWTPASTSGKPRKEKAPGK FYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYR RCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGMIYTVGYSMSLASLTVAV LILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQ VPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTI FGWGLPAVFVAVWVGVRATLANTGCWDLSSGHKKWIIQVPILASVVLNFILFINIIRVLA TKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPYTEVSGTLWQIQMHYEML FNSFQGFFVAIIYCFCNGEVQAEIRKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVT NVGPRAGLSLPLSPRLLPATTNGHSQLPGHAKPGAPAIENETIPVTMTVPKDDGFLNGSC SGLDEEASGSARPPPLLQEEWETVM
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Knock-down of PTHR1 reveals its pro-malignant effects in osteosarcoma cells. PMID: 29121993
  2. ZFPM2, LEF1, NR4A2, HAS2, and RHOC might be potential targets of PTHR1 in osteosarcoma. PMID: 28934958
  3. Pth1r in DMP1-8kb-expressing cells is required to maintain basal levels of bone resorption but is dispensable for the catabolic action of chronic PTH elevation. PMID: 27704638
  4. Results provide in vivo evidence of a role for RAMP2 in placental development distinct from the RAMP2-calcitonin receptor-like receptor/adrenomedullin signaling paradigm; decreases Pthr1 expression and causes a blunted response to systemic parathyroid hormone; and identify additional pathways underlying the endocrine and fertility defects of the previously characterized Ramp2 heterozygous adult females. PMID: 28727763
  5. Activation of PTHrP-cyclic AMP-CREB1 signaling following p53 loss is essential for osteosarcoma initiation and maintenance. PMID: 27070462
  6. A critical role for SNX27-retromer mediated transport of PTHR in normal bone development. PMID: 26912788
  7. we propose that PTH has a direct effect on osteoblasts and osteoclasts, and that this effect is mediated through PTH1R, thus contributing to bone remodeling PMID: 26647715
  8. cells expressing osterix are mesenchymal progenitors contributing to all relevant cell types during morphogenesis. PMID: 27068606
  9. PTH1R regulates systemic mineral ion homeostasis and induction of FGF23. PMID: 26428657
  10. PTH1R is an important component of mechanical signal transduction in osteocytic MLO-Y4 cells. PMID: 25529820
  11. These studies reveal that PTH1R signaling in osteoblasts regulates cartilaginous growth plate for postnatal growth of bone. PMID: 25196529
  12. PTH receptor signaling enhances bone resorption by directly regulating Rankl gene expression in osteocytes. PMID: 24877630
  13. Data suggest that parathyroid hormone (PTH) receptor signaling could enhance the therapeutic potential of the pathway. PMID: 23963454
  14. Data indicate that PTH/PTH-related peptide (PTHrP) type 1 receptor (PPR) signaling in osteocytes is required for bone remodeling. PMID: 23729679
  15. PTH-induced phosphorylation of the PTHR1 in is important in regulating acute ligand responses PMID: 23533279
  16. LCPUFAs, EPA and DHA, can activate PTH1R receptor at nanomolar concentrations and consequently provide a putative molecular mechanism for the action of fatty acids in bone PMID: 23300710
  17. The IRE1alpha-XBP1 pathway positively regulates parathyroid hormone (PTH)/PTH-related peptide receptor expression and is involved in PTH-induced osteoclastogenesis. PMID: 23235147
  18. Data implicate a functional interaction between parathyroid hormone type 1 receptor (PTHR) and beta(2)-adrenergic receptor (beta(2)AR) controls bone formation and parathyroid hormone (PTH) anabolism. PMID: 22538810
  19. direct PPR signaling in T cells plays an important role in PTH-induced bone anabolism by promoting T-cell production of Wnt10b PMID: 22393015
  20. These results indicate that constitutive activation of PTH/PTHrP receptor in differentiated osteoblasts enhances bone marrow ablation-induced recruitment, proliferation, and differentiation of osteoprogenitors. PMID: 21866553
  21. PTH receptor signaling has the potential to modulate the endocrine and auto/paracrine functions of osteocytes by regulating FGF23 through cAMP- and Wnt-dependent mechanisms. PMID: 21726676
  22. PTH receptor signaling influences cortical bone through actions on osteocytes and defines the role of Wnt signaling in PTH receptor action. PMID: 21140374
  23. Inactivation of PPR in chondrocytes postnatally leads to accelerated differentiation of chondrocytes, followed by disappearance of the growth plate. PMID: 21173257
  24. Adipocyte-PTHR, an all-trans retinoic acid-responsive gene, was found to be an up-stream regulator of pleiotrophin. PMID: 20974122
  25. In primary calvarial osteoblasts from 2-week-old phosphorylation-deficient or wild-type mice, PTH and PTH-related peptide receptor decreased the levels of phosphorylated extracellular signal-regulated kinases 1/2 and cyclin D1. PMID: 20929987
  26. PTH receptor 1 signaling in T cells plays an essential role in parathyroid hormone induced bone loss PMID: 20808842
  27. PLC signaling through the PTHR is required for skeletal homeostasis. PMID: 20501677
  28. TGFBR2 forms an endocytic complex with PTH1R in response to PTH and regulates signalling by PTH and TGF-beta. TGFBR2 directly phosphorylates the PTH1R cytoplasmic domain, which modulates PTH-induced endocytosis of the PTH1R-TGFBR2 complex. PMID: 20139972
  29. The variety of the PTH/PTHrP receptor mRNA expression during hair cycling suggest that PTH, PTHrP and their receptors might participate in the regulation of hair cycle in mice skin. PMID: 12413769
  30. findings indicate that the parathyroid hormone type 1 receptor is required for the development of normal cardiomyocyte function PMID: 12586782
  31. Pthr immunoreactivity was demonstrated in epithelial cells of striated, interlobular and main excretory ducts of the sublingual gland. It was absent in the epithelial cells of the intercalated ducts. PMID: 12705476
  32. Smooth-muscle-specific overexpression of PTH/PTHrP type 1 receptor resulted in more vasodilation to saline volume expansion and less vasoconstriction to ANG II. Can act as endogenous vasorelaxant factor to modulate renal responses to vasoactive stimuli. PMID: 12960101
  33. Gsalpha is the primary mediator of the actions of the Pthrp receptor in growth plate chondrocytes. PMID: 15459318
  34. The PTH/PTHrP signaling is a major regulator of the ontogeny of the bone marrow and its stromal tissue, and of the skeletal stem cell compartment. PMID: 15611335
  35. Upregulation of PTH/PTHrP receptor mRNA expression in the developing growth plate. PMID: 15771625
  36. Reduced smooth muscle appears to underlie the majority of nipple deficiencies in mice with lower levels of the Ppr expression PMID: 15880431
  37. An unexpected interaction is found between parathyroid hormone-related protein (PTHrP) and Runx2 in controlling the rate of chondrocyte proliferation. PMID: 16476422
  38. fetal skins of the PTHrP and PPR knockouts (KOs) had reciprocal increases in the length, diameter, and density of capillaries PMID: 16675960
  39. PTHR1 signaling in osteocytes is sufficient for inhibition of Sost expression and leads to a concomitant increase in bone mass. PMID: 17185824
  40. PTH1R shuttles from the nucleus to the cytoplasm under normal physiological conditions and that this nuclear-cytoplasmic transport is dependent upon importin-alpha/beta and CRM1 PMID: 17317770
  41. constitutive activation of PTH/PTHrP receptor signaling in osteoblastic cells suppresses unloading-induced bone loss specifically through the regulation of osteoclastic activity. PMID: 17500070
  42. betaAr-dependent late phase of ERK activation by PTH requires the participation of betaAr2 and PTH1R internalization PMID: 17525124
  43. PTH(1-34) and PTHrP(7-34) induce a conformational change in the PTH1R that promotes arrestin binding and dissociates NHERF1 from PTH1R internalization. PMID: 17526947
  44. As compared with PTH(1-34), M-PTH(1-34) bound to R(0) PTHR conformation with higher affinity and induced larger increases in trabecular bone volume and greater increases in cortical bone turnover PMID: 18946036

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Detected in kidney.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X