Recombinant Mouse Probable G-protein coupled receptor 27(Gpr27)

Code CSB-CF009799MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O54897
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MANASEPGGGGSGGGAEAAALGLRLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLL LDLCLADGLRALACLPAVMLAARRAAAAAGTPPGALGCKLLAFLAALFCFHAAFLLLGVG VTRYLAIAHHRFYAERLAGWPCAAMLVCAAWALALAAAFPPVLDGGGADDEDAPCALEQR PDGAPGALGFLLLLAAVVGATHLVYLRLLFFIHDRRKMRPARLVPAVSHDWTFHGPGATG QAAANWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEKRLCKMFYAITLLFLLL WGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFRAQFPCC QSPQATQATLPCDLKGIGL
Source in vitro E.coli expression system
Gene Names Gpr27
Protein Names Recommended name: Probable G-protein coupled receptor 27 Alternative name(s): Super conserved receptor expressed in brain 1
Expression Region 1-379
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor. Possible candidate for amine-like G-protein coupled receptor (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:14761

STRING: 10090.ENSMUSP00000098680

UniGene: Mm.394313

Related Products

Gpr27 Proteins

Gpr27 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.