Recombinant Mouse Putative P2Y purinoceptor 10(P2ry10)

Code CSB-CF803843MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8BFU7
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MGSNSTSSAESNCNATYLPFQYSLYATTYIFIFIPGLLANSAALWVLCRFISKKNKAIIF MINLSVADLAHILSLPLRIYYYINRHWPFQRALCLLCFYLKYLNMYASIFFLTCISLQRC LFLLKPFRARNWKRRYDVGISAVIWIVVGTACLPFPILRNAGLANSTDSCFADLGYKQMD AVVLVTMVVIAELAGFVIPVITIACCTWKTTVSLKHPPIAFQGISERKKALRMVFMCAAV FVICFTPYHINFIFYTMVKESIITSCPTVKSTLYFHPFSLCLASLCCLLDPILYYFMASE FRDQLSRHGSSVTRSRLMSRESGSSMVN
Source in vitro E.coli expression system
Gene Names P2ry10
Protein Names Recommended name: Putative P2Y purinoceptor 10 Short name= P2Y10
Expression Region 1-328
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative receptor for purines coupled to G-proteins.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:78826

STRING: 10090.ENSMUSP00000061296

UniGene: Mm.74639

Related Products

P2ry10 Proteins

P2ry10 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.