Recombinant Mouse Relaxin-3 receptor 1(Rxfp3)

Code CSB-CF804323MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8BGE9
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MQVASATPAATVRKAAAGDELSEFFALTPDLLEVANASGNASLQLQDLWWELGLELPDGA APGHPPGGGGAESTDTEARVRILISAVYWVVCALGLAGNLLVLYLMKSKQGWRKSSINLF VTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVAR YHSVASALKSHRTRGRGRGDCCGQSLRESCCFSAKVLCGLIWASAALASLPNAIFSTTIR VLGEELCLMHFPDKLLGWDRQFWLGLYHLQKVLLGFLLPLSIISLCYLLLVRFISDRRVV GTTDAVGAAAAPGGGLSTASARRRSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNAV PFSQEYFQCQVYAFPVSVCLAHSNSCLNPILYCLVRREFRKALKNLLWRIASPSLTNMRP FTATTKPEPEDHGLQALAPLNAAAEPDLIYYPPGVVVYSGGRYDLLPSSSAY
Source in vitro E.coli expression system
Gene Names Rxfp3
Protein Names Recommended name: Relaxin-3 receptor 1 Short name= RLN3 receptor 1 Alternative name(s): G protein-coupled receptor SALPR homolog Relaxin family peptide receptor 3
Expression Region 1-472
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for RNL3/relaxin-3. Binding of the ligand inhibit cAMP accumulation (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:239336

STRING: 10090.ENSMUSP00000062741

UniGene: Mm.209312

Related Products

Rxfp3 Proteins

Rxfp3 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.