Recombinant Mouse Rhodopsin(Rho)

Code CSB-CF019681MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P15409
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MNGTEGPNFYVPFSNVTGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVVFTWIMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIFFLICWLPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSI YNPVIYIMLNKQFRNCMLTTLCCGKNPLGDDDASATASKTETSQVAPA
Source in vitro E.coli expression system
Gene Names Rho
Protein Names Recommended name: Rhodopsin
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth
Subcellular Location Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Rod-shaped photoreceptor cells in the retina (at protein level).
Database Links

KEGG: mmu:212541

STRING: 10090.ENSMUSP00000032471

UniGene: Mm.2965

Related Products

Rho Proteins

Rho Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.