Recombinant Mouse Rhodopsin (Rho)

Code CSB-CF019681MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Rho; Rhodopsin
Species
Mus musculus (Mouse)
Expression Region
1-348
Target Protein Sequence
MNGTEGPNFYVPFSNVTGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVVFTWIMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIFFLICWLPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSI YNPVIYIMLNKQFRNCMLTTLCCGKNPLGDDDASATASKTETSQVAPA
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling.
Gene References into Functions
  1. Autosomal dominant retinitis pigmentosa rhodopsin mutant Q344X drives specific alterations in chromatin complex gene transcription. PMID: 29463953
  2. we show that OPN2 and OPN4 participate in immediate pigment darkening induced by UVA in murine normal and malignant melanocytes through a conserved common pathway PMID: 29395480
  3. Photoactivation of rhodopsin increases near-Infrared backscattering from rods and causes lengthening of their rod outer segment. PMID: 28320964
  4. Specific visible radiation facilitates lipolysis in mature 3T3-L1 adipocytes via rhodopsin-dependent beta3-adrenergic signaling. PMID: 28483278
  5. By modifying culture conditions in the SFEBq protocol, we obtained rod-dominated 3D retinas and S- and M-opsin expressing 3D retinas. PMID: 29274337
  6. Rab8a and Rab11a Are Dispensable for Rhodopsin Transport in Mouse Photoreceptors PMID: 27529348
  7. This study demonstrated that Rhodopsin Phosphorylation on Dark Adaptation in Mouse Rods. PMID: 27358455
  8. Findings indicate that Rho and ROCK knockout may improve the behavior of mice and prevent MPTP-induced dopaminergic neurons damage by regulating Sema3A, PlexinA and NRP-1 in a mouse model of Parkinson's disease. PMID: 27772760
  9. The authors elucidated this dependency by showing that guanylate cyclase-1 is a novel rhodopsin-binding protein. PMID: 26590321
  10. Eliminating Cngb1 and reducing RDS leads to additive defects in RDS expression levels and rod electroretinogram (ERG) function, (e.g., Cngb1-/-/rds+/- versus rds+/- or Cngb1-/-) but not to additive defects in rod ultrastructure. PMID: 26934134
  11. These findings reveal that an early and significant pathophysiologic effect of endoplasmic reticulum stress in photoreceptors is the highly efficient elimination of misfolded rhodopsin protein. PMID: 25270370
  12. Data show that G90D1 ribozyme efficiently and specifically cleaved the mutant transcript of the G90D mutation in the rhodopsin gene while G90D2 ribozyme cleaved both WT and mutant transcript. PMID: 26427453
  13. These results provide precise genotypic information of the P23H-1 rat with additional phenotypic characterization that will serve basis for therapeutic interventions, especially for those aiming at gene editing. PMID: 26009893
  14. Data show that misfolded opsin mutants form aggregates in the endoplasmic reticulum. PMID: 26358292
  15. Data show that the step-like responses of serine-only rhodopsin reflect slow and stochastic arrestin binding. PMID: 25910054
  16. Data indicate that genomic sequences from the rhodopsin gene can improve the efficacy of rhodopsin gene therapy in the rhodopsin knockout (RKO) mouse model of retinitis pigmentosa (RP). PMID: 25713057
  17. Peripherin-2 links CNGB1 to the light-detector rhodopsin in outer segments of rod photoreceptors. PMID: 24963162
  18. p27(kip1) promotes mesenchymal migration and hinders amoeboid migration upstream of the Rho/ROCK pathway. PMID: 25015295
  19. Data indicate that the number of nanodomains present in a single disc was dependent on the number of rhodopsin molecules incorporated into the membrane. PMID: 25305340
  20. mice deficient in the TWIK-2 channel develop pulmonary hypertension between 8 and 20 weeks of age through a mechanism involving Rho-kinase. PMID: 25245387
  21. P23H mutant Rho can trigger phototransduction but Rho P23H/P23H rods are 17,000-fold less sensitive to light than Rho +/+ rods and produce abnormally fast photo-responses. PMID: 24214395
  22. During development, some rhodopsin-expressing cells are displaced to the inner retinal layers. PMID: 24496510
  23. We created the T17M RHO CASP7 and T17M RHO CHOP mice to study the impact of the CASP7 or CHOP ablations in T17M RHO retina. PMID: 24664731
  24. We examine and compare the contribution of endoplasmic reticulum stress to retinal degeneration in several vertebrate models of retinitis pigmentosa generated through expression of mutant rhodopsins. PMID: 24664747
  25. rod outer segments lengthen and its rhodopsin concentration rises to increase photon capture in darker environment. PMID: 23985328
  26. The results reveal that the volume of the rod outer segment is proportional to rhodopsin gene expression; that P23H-rhodopsin, the most common rhodopsin gene disease allele, causes cell death via a dominant-negative mechanism PMID: 23185477
  27. This study demonistrated that the Muller glia express rhodopsin in a mouse model of inherited retinal degeneration. PMID: 22967839
  28. Autosomal recessive retinitis pigmentosa E150K opsin mice exhibit photoreceptor disorganization. PMID: 23221340
  29. Rhodopsin expression level affects rod outer segment morphology and photoresponse kinetics PMID: 22662234
  30. Stimulation of channel rhodopsin 2-containing fibers with millisecond flashes of blue light produces fast postsynaptic currents in tuberomammillary histamine neurons. PMID: 22956835
  31. analysis of structural, energetic, and mechanical perturbations in rhodopsin mutant that causes congenital stationary night blindness PMID: 22549882
  32. The endoplasmic reticulum stress response is involved in retinal degeneration in mice with rhodopsin mutation T17M PMID: 22589437
  33. A new mutation in rhodopsin was identifies in a mouse model of retinal degeneration. PMID: 22183357
  34. Adeno-associated virus delivery of wild-type rhodopsin preserves retinal function in a mouse model of autosomal dominant retinitis pigmentosa PMID: 21126223
  35. Role of bulk water in hydrolysis of the rhodopsin chromophore. PMID: 21460218
  36. The amino acid residues that differ naturally between mouse and bovine rhodopsin appear to have minimal bearing on molecular interactions stabilizing structural segments and unfolding intermediates; no major differences in unfolding energy are observed. PMID: 21038881
  37. High levels of retinal docosahexaenoic acid do not protect mice expressing the VPP rhodopsin mutation from retinal degeneration. PMID: 20806040
  38. Mutations of the opsin gene lead to light-induced degeneration of photoreceptors and constitutive activation of phototransduction. PMID: 20207741
  39. Rhodopsin phosphorylation has three physiological functions: it quenches phototransduction, reduces sensitivity during light adaptation, and suppresses bleached rhodopsin activity during dark adaptation. PMID: 20155952
  40. Progressive photoreceptor degeneration, outer segment dysplasia, and rhodopsin mislocalization in mice with targeted disruption of the retinitis pigmentosa-1 (Rp1) gene. PMID: 11960024
  41. Atomic-force microscopy of rhodopsin dimers in native disc membranes PMID: 12520290
  42. structure of rhodopsin and opsin dimer in native membranes PMID: 12663652
  43. Data describe the organization of the prototypical G protein-coupled receptor rhodopsin in its native membrane by electron and atomic force microscopy. PMID: 15111110
  44. Data suggest that the differences in physiological responses measured in wild type and rhodopsin knockout mice are due to structural changes of the whole rod outer segment and not due to a lower density of rhodopsin. PMID: 15337746
  45. palmitoylation may modulate rod photoreceptor sensitivity by permitting rhodopsin to remain active for a longer period PMID: 15851469
  46. rods generate reproducible single-photon responses; this reproducibility, consistency of amplitude & duration of rhodopsin activity, varies in a graded & systematic manner with the number but not identity of phosphorylation sites on rhodopsin's C terminus PMID: 16873665
  47. reveals how the molecular properties of rhodopsin affect the amplitude, shape, and kinetics of the rod response PMID: 17194706
  48. A single Rho molecule is necessary and sufficient to bind Arrestin. PMID: 17360618
  49. These experiments indicate that mutations of rhodopsin( Gly90Asp ) that lead to increases in cGMP and Ca(2+) can trigger photoreceptor degeneration. PMID: 17699662
  50. A STAT3-dependent E3 ubiquitin ligase, Ubr1, was responsible for rhodopsin degradation and was up-regulated in the inflamed SOCS3-deficient retinas. PMID: 18614536

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity
Rod-shaped photoreceptor cells in the retina (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1