Recombinant Mouse Short-wave-sensitive opsin 1(Opn1sw)

Code CSB-CF016354MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P51491
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MSGEDDFYLFQNISSVGPWDGPQYHLAPVWAFRLQAAFMGFVFFVGTPLNAIVLVATLHY KKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTG WSLAFLAFERYVVICKPFGSIRFNSKHALMVVLATWIIGIGVSIPPFFGWSRFIPEGLQC SCGPDWYTVGTKYRSEYYTWFLFIFCFIIPLSLICFSYSQLLRTLRAVAAQQQESATTQK AEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLDLRLVTIPAFFSKSSCVYNPII YCFMNKQFRACILEMVCRKPMADESDVSGSQKTEVSTVSSSKVGPH
Source in vitro E.coli expression system
Gene Names Opn1sw
Protein Names Recommended name: Short-wave-sensitive opsin 1 Short name= S opsin Alternative name(s): Blue cone photoreceptor pigment Blue-sensitive opsin Short name= BOP Short wavelength-sensitive cone opsin
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. May increase spectral sensitivity in dim light.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Expressed in cone photoreceptor cells.
Database Links

KEGG: mmu:12057

STRING: 10090.ENSMUSP00000079289

UniGene: Mm.56987

Related Products

Opn1sw Proteins

Opn1sw Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.