Recombinant Mouse Somatostatin receptor type 1 (Sstr1)

Code CSB-CF022724MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Sstr1; Smstr1; Somatostatin receptor type 1; SS-1-R; SS1-R; SS1R; SRIF-2
Species
Mus musculus (Mouse)
Expression Region
1-391
Target Protein Sequence
MFPNGTASSPSSSPSPSPGSCGEGACSRGPGSGAADGMEEPGRNASQNGTLSEGQGSAIL ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS RAYSVEDFQPENLESGGVFRNGTCASRISTL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for somatostatin with higher affinity for somatostatin-14 than -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and Na(+)/H(+) exchanger via pertussis toxin insensitive G proteins.
Gene References into Functions
  1. This study showed that reduced expression of the Sstr1 which modulate antidepressant action in hippocampus. PMID: 25784603
  2. The expression and localization of the three receptors (SSTR3-SSTR5) in wild-type (WT), single-knockout (SSTR1 KO) and double-knockout SSTR1/SSTR2 (DKO) mice, are reported. PMID: 25149275
  3. SSTR1 was expressed in Kolliker's organ on E14, on cochlear duct hair cells & supporting cells on E17 and only on the organ of Corti at birth, increasing & peaking at P14 but dropping off at P21. PMID: 22986312
  4. SSTR1-like immunoreactivity increases in hypothalamus except in paraventricular nucleus of ApoD(-/-) mice. PMID: 22581439
  5. SST and SSTRs might play an important role in regulation of neurodegeneration PMID: 21912697
  6. Data suggest an important role for the brain somatostatin receptor 1 subtype in the modulation of the gastrointestinal response to activation of brain CRF pathways. PMID: 21564422
  7. The effect of sst2 receptor knockout on sst1 receptor mRNA localization and binding sites throughout the brain has been determined. PMID: 11897118
  8. The localization of somatostatin to retinal amacrine cells, together with the expression of somatostatin receptors in amacrine, bipolar and horizontal cells suggests that somatostatin acts at multiple levels of retinal circuitry. PMID: 11988224
  9. sst1 receptor loss causes a significant increase in retinal levels of somatostatin-14 (SRIF) whereas it does not affect SRIF messenger RNA, indicating that sst1 receptors play a role in limiting retinal SRIF at the post-transcriptional level. PMID: 14614951
  10. somatostatin receptors 1 and 2 are expressed in the adult mouse kidney PMID: 15093692
  11. SSTR1 plays an important role in the regulation of insulin secretion in the endocrine pancreas in mice. PMID: 16406265
  12. SSTR1 activation can inhibit insulin secretion in pancreatic beta-cells. PMID: 18845633

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Jejunum and stomach.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1