Recombinant Mouse Trace amine-associated receptor 9(Taar9)

Code CSB-CF722178MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5QD04
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MTSDFSPEPPMELCYENVNGSCIKSSYAPWPRAILYGVLGLGALLAVFGNLLVIIAILHF KQLHTPTNFLVASLACADFLVGVTVMPFSTVRSVESCWYFGESYCKFHTCFDTSFCFASL FHLCCISIDRYIAVTDPLTYPTKFTVSVSGLCIALSWFFSVTYSFSIFYTGANEEGIEEL VVALTCVGGCQAPLNQNWVLLCFLLFFLPTVVMVFLYGRIFLVAKYQARKIEGTANQAQA SSESYKERVAKRERKAAKTLGIAMAAFLVSWLPYIIDAVIDAYMNFITPAYVYEILVWCV YYNSAMNPLIYAFFYPWFRKAIKLIVSGKVFRADSSTTNLFSEEAGAG
Source in vitro E.coli expression system
Gene Names Taar9
Protein Names Recommended name: Trace amine-associated receptor 9 Short name= TaR-9 Short name= Trace amine receptor 9
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan olfactory receptor specific for trace amines.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Specifically expressed in neurons of the olfactory epithelium.
Database Links

KEGG: mmu:503558

STRING: 10090.ENSMUSP00000043552

UniGene: Mm.300923

Related Products

Taar9 Proteins

Taar9 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.