Recombinant Mouse Tumor necrosis factor receptor superfamily member 6 (Fas)

Code CSB-CF008433MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Fas; Apt1; Tnfrsf6; Tumor necrosis factor receptor superfamily member 6; Apo-1 antigen; Apoptosis-mediating surface antigen FAS; FASLG receptor; CD antigen CD95
Species
Mus musculus (Mouse)
Expression Region
22-327
Target Protein Sequence
QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.
Gene References into Functions
  1. our computational and experimental approach identified Fas as a regulator of the Th17-to-Th1 cell balance by controlling the availability of opposing STAT1 and STAT3 to have a direct impact on autoimmunity. PMID: 29562202
  2. FGF21 alleviated atherosclerosis by ameliorating Fas-mediated apoptosis in apoE-/- mice. PMID: 30157856
  3. TPD7 altered the extrinsic apoptosis pathway by upregulating Fas expression. PMID: 29901176
  4. In conclusion, these data demonstrate that murine herpesvirus 68-immortalized SL-1 cells can be recognized and controlled by specific cytotoxic T cells through CD95/CD95L-mediated apoptosis. PMID: 28516317
  5. Findings indicate that induction of apoptosis through Fas is dependent on receptor palmitoylation in primary immune cells, and Fas may prevent autoimmunity by mechanisms other than inducing apoptosis. PMID: 28008916
  6. Both Sharpin/Fas and Sharpin/Fasl compound mutant mice developed an auto-inflammatory phenotype similar to that seen in Sharpin null mice, indicating that initiation of apoptosis by FAS signalling is likely not involved in the pathogenesis of this disease. PMID: 28094869
  7. Tag7 activates lymphocytes capable of Fasl-Fas-dependent contact killing of virus-infected cells. PMID: 29083508
  8. leucine deprivation induces the expression of miR-212-5p in a GCN2/ATF4-dependent manner. miR-212-5p suppresses lipid accumulation in liver by targeting FAS and SCD1 under both normal diet and high-fat diet conditions. PMID: 28667176
  9. Our data show that loss of Fas activity strongly affects the early development of atopic dermatitis (AD) by leading to Th2-dominant inflammation characterized by dermal infiltration of CD4+ T cells, neutrophils and increased skin expression of Th2 cytokines.However, Fas/FasL-apoptotic pathway is also involved in restricting tissue remodelling and dermal fibrosis during AD. PMID: 28434120
  10. Hrd1-null B cells exhibited high Fas expression during activation and rapidly underwent Fas-mediated apoptosis, which could be largely inhibited by FasL neutralization. Fas mutation in Hrd1 KO mice abrogated the increase in B-cell AICD. We identified Hrd1 as the first E3 ubiquitin ligase of the death receptor Fas and Hrd1-mediated Fas destruction as a molecular mechanism in regulating B-cell immunity. PMID: 27573825
  11. FAS contributes to mitochondrial dysfunction, steatosis development, and insulin resistance under high fat diet. PMID: 28883393
  12. These findings reveal a role for MOAP-1 in Fas signaling in the liver by promoting MTCH2-mediated tBid recruitment to mitochondria. PMID: 27320914
  13. The in vivo delivery of CRISPR/Cas9 could maintain liver homeostasis and protect hepatocytes from Fas-mediated cell apoptosis in the fulminant hepatic failure model. PMID: 27585307
  14. This study demonstrated that Ischemic neurons release sFasL, which contributes to M1-microglial polarization. PMID: 27283206
  15. results indicate that IL-1beta, produced by the inflammasome and Fas-dependent mechanisms, contributes cooperatively to the Th17/Th1 induction during bacterial infection. This study provides a deeper understanding of the molecular mechanisms underlying Th17/Th1 induction during pathogenic microbial infections in vivo. PMID: 28674179
  16. this study shows that CD95-mediated calcium signaling promotes Th17 cell trafficking to inflamed organs in lupus-prone mice PMID: 27438772
  17. accelerating effects of Tlr9 deficiency PMID: 28278279
  18. K8/K18-dependent PKCdelta- and ASMase-mediated modulation of lipid raft size can explain the more prominent FasR-mediated signaling resulting from K8/K18 loss. PMID: 27422101
  19. Data show that TCF1 proteindeficiency relieved most manifestations of autoimmune lymphoproliferative syndrome (ALPS)-like phenotype, which were caused by Fas protein mutation in TCF1(-/-) lpr/lpr mice. PMID: 28349581
  20. Results indicate that the close interaction between Thy-1 and Fas in lipid rafts regulates fibroblast apoptosis, and decreased fibroblast apoptosis associated with myofibroblast accumulation in mice lacking Thy-1. PMID: 28165468
  21. Fas/FasL Complex Promotes Proliferation and Migration of Brain Endothelial Cells Via FADD-FLIP-TRAF-NF-kappaB Pathway PMID: 25427888
  22. Cardiac Fas-dependent and mitochondria-dependent apoptotic pathways were activated in transgenic mice with Huntington's disease. PMID: 25800750
  23. The MWM showed that compared with FAS- and FASL-knockout mice treated with sevoflurane, sevoflurane treatment of wild-type mice significantly prolonged the escape latency and reduced platform crossing times. PMID: 26782453
  24. the individual functions of the NF-kappaB family members NF-kappaB1, NF-kappaB2 and c-REL in the various autoimmune pathologies of Fas(lpr/lpr) mutant mice, were investigated. PMID: 26084385
  25. When Bax(-/-)Bak(-/-) murine embryonic stem cells (ESCs) are stimulated to differentiate, a subpopulation fails to do so and instead upregulates FAS in a p53-dependent manner to trigger Bax/Bak-dependent apoptosis. PMID: 26585277
  26. These results demonstrate that during ectromelia virus infection, Fas/FasL can regulate development of tolerogenic DCs and Tregs, leading to an ineffective immune response. PMID: 26780774
  27. Data determined the transmembrane domain structure of Fas and showed that the trimer assembly, which is mediated by a proline-containing motif, is essential for Fas signaling providing structural explanation for many known cancer mutations in this domain. PMID: 26853147
  28. Impaired Fas-Fas Ligand Interactions Result in Greater Recurrent Herpetic Stromal Keratitis in Mice PMID: 26504854
  29. miR-150 deficiency prevents Fas-induced hepatocyte apoptosis and liver injury through regulation of the Akt pathway PMID: 26196694
  30. CD47 deficiency ameliorates lupus nephritis in Fas(lpr) mice via suppression of IgG autoantibody production. PMID: 26095930
  31. The upregulation of p-FADD/FADD ratio and NF-kappaB in mouse hippocampus after Kainic acid treatment PMID: 26044520
  32. demonstrates that Fas/FasL pathway during ectromelia virus infection of the lungs plays an important role in controlling local inflammatory response and mounting of antiviral response PMID: 25873756
  33. Mice with the Fas(lpr) gene developed severe systemic lupus erythematosus with renal dysfunction and inflammatory responses in the lung and kidney. By contrast, mice with the Fas(+) gene showed disease-related abnormalities in the liver and joints. PMID: 25941813
  34. Occlusive lung arterial lesions triggering pulmonary arterial hypertension developed in a new model of endothelial-targeted, Fas-induced apoptosis transgenic mice. PMID: 25879383
  35. Gene silencing of liver Fas expression completely attenuated apoptotic and necrotic cell death. PMID: 25601293
  36. Our results demonstrate that Fas/FasL can regulate development of tolerogenic dendritic cells and expansion of Tregs early during HSV-2 infection, which further influences effective anti-viral response. PMID: 25129477
  37. our data support a model in which IFNgamma- and Fas/FasL-dependent activation of intratumoral Mvarphis by CD8(+) T cells promotes severe intraocular inflammation that indirectly eliminates intraocular tumors by inducing phthisis. PMID: 25248763
  38. Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD95. PMID: 24981893
  39. These data provide the first in vivo genetic evidence that neutrophil lifespan is controlled by death receptor signaling and provide a mechanism to account for neutrophil resistance to Fas stimulation during infection. PMID: 25473101
  40. Intestinal expression of Fas and Fas ligand is upregulated by bacterial signaling through TLR4 and TLR5, with activation of Fas modulating intestinal TLR-mediated inflammation. PMID: 25378591
  41. overexpression of Fas/FasL is associated with infectious complications and severity of experimental severe acute pancreatitis by promoting apoptosis of lymphocytes PMID: 24566874
  42. No significant association between FAS-670G/A polymorphism and susceptibility to autoimmune hepatitis was found. PMID: 24629822
  43. a key role of MK2 and FasR in the regulation and limitation of the immune response in the CNS PMID: 24964076
  44. These data show that loss of Fas activity specifically in chondrocytes prolonged the life span of chondrocytes and that Fas synergized with TNFalpha signaling to mediate chondrocyte apoptosis. PMID: 24677136
  45. Although expression of Fas and TNF-R1 was proportionate to fractional apoptosis, cell death was dominated by spontaneous apoptosis in stem cell mobilization. PMID: 24566711
  46. Data suggest that toll-like receptor 3 (TLR3), phosphatidylinositol 3-kinase (PI3K), survivin, Fas ligand (FasL), and CD95 (Fas) genes are involved in the development of cervical cancer. PMID: 25106857
  47. The Fas KO mice spontaneously develop blepharitis with not only autoimmune inflammation with deposition of auto-antibody but also allergic inflammation with infiltration by eosinophils and show to increase serum level of IgE and IgG1. PMID: 23220580
  48. D-cyclins repress the expression of the death receptor Fas and its ligand, FasL PMID: 25087893
  49. Data indicate that dendritic cells (DCs)-specific CD95 (Fas) expression plays a role in regulation of antiviral responses and suggests a strategy for stimulation of T cells for virus clearance in chronically infected animal and human. PMID: 24912151
  50. Combined adenovirus-mediated artificial microRNAs targeting mfgl2, mFas, and mTNFR1 protect against fulminant hepatic failure in mice. PMID: 24303082

Show More

Hide All

Involvement in disease
Defects in Fas are the cause of the lymphoproliferation phenotype (lpr). Lpr mice show lymphadenopathy and autoantibody production.
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.
Tissue Specificity
Detected in various tissues including thymus, liver, lung, heart, and adult ovary.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1