Recombinant Pan troglodytes Short-wave-sensitive opsin 1(OPN1SW)

Code CSB-CF016354EQV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P60015
Storage Buffer Tris-based buffer,50% glycerol
Species Pan troglodytes (Chimpanzee)
Sequence MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATL RYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLV TGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGL QCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATT QKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNP IIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN
Source in vitro E.coli expression system
Gene Names OPN1SW
Protein Names Recommended name: Short-wave-sensitive opsin 1 Alternative name(s): Blue cone photoreceptor pigment Blue-sensitive opsin Short name= BOP
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity The three color pigments are found in the cone photoreceptor cells.
Database Links

KEGG: ptr:472508

STRING: 9598.ENSPTRP00000033678

UniGene: Ptr.6234

Related Products

OPN1SW Proteins

OPN1SW Proteins for Pan troglodytes (Chimpanzee)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.