Recombinant Pig Melanocyte-stimulating hormone receptor(MC1R)

Code CSB-CF886941PI
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names MC1R
Uniprot No. Q9TU05
Alternative Names MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Species Sus scrofa (Pig)
Expression Region 1-320
Target Protein Sequence MPVLGPERRLLASLSSAPPAAPRLGLAANQTNQTGPQCLEVSIPDGLFLSLGLVSLVENV LVVAAIAKNRNLHSPMYYFVCCLAVSDLLVSVSNVLETAVLLLLEAGALAAQAAVVQQLD NVMDVLICGSMVSSLCFLGAIAVDRYVSIFYALRYHSIVTLPRAGRAIAAIWAGSVLSST LFIAYYHHTAVLLGLVSFFVAMLALMAVLYVHMLARACQHGRHIARLHKTQHPTRQGCGL KGAATLTILLGVFLLCWAPFFLHLSLVVLCPQHPTCGCVFKNVNLFLALVICNSIVDPLI YAFRSQELRKTLQEVLQCSW
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Mediates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), via regulation of cAMP signaling in melanocytes.
Gene References into Functions
  1. A 2-bp insertion (c.67_68insCC) in MC1R causes recessive white coat color in Bama miniature pigs PMID: 28411032
  2. The MC1R gene, located on porcine chromosome 6, is responsible for the Extension coat color locus in Sus scrofa. PMID: 25134014
  3. Melanocortin receptor 1 gene was not the principal factor affecting the coat color differences of Chinese native pig breeds, but could be used to trace the molecular evolution of pig breeds PMID: 15524286
  4. Mutational analysis of the MC1R loci in relation to coat color. PMID: 16734703
  5. Variations in the MC1R gene are associated with coat color. PMID: 16978185
  6. The Chinese Rongchang pig has the dominant black E(D1) allele at the melanocortin 1 receptor (MC1R) locus. PMID: 17150979
  7. Breed specific mutations of the MC1 receptor in an Italian breed of swine. PMID: 17682921
  8. 668G-->C, 1318C-->T, and 1554G-->A may be associated with the recessive red color in the Duroc breed, and nt894insCC making 1197G-->A nonsense may be associated with the white color in Landrace and Yorkshire breeds. PMID: 17884687

Show More

Hide All

Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: ssc:494018

STRING: 9823.ENSSSCP00000027395

UniGene: Ssc.42761

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1