Recombinant Pig Vesicle-associated membrane protein-associated protein B(VAPB)

Code CSB-CF025790PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A5GFS8
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Sus scrofa (Pig)
Sequence AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPADTSDMEAAWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPVVSKALSSALDDTEVKKVMEECKRLQSEVQRLREENKQLKEEDGLRMRKPVLSNSPAPAPATPGKEEGLSTRLLALVVLFFIVGVIIGKIAL
Source in vitro E.coli expression system
Gene Names VAPB
Protein Names Recommended name: Vesicle-associated membrane protein-associated protein B Short name= VAMP-B Short name= VAMP-associated protein B Short name= VAP-B
Expression Region 2-243
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation.
Subcellular Location Endoplasmic reticulum membrane, Single-pass type IV membrane protein
Protein Families VAMP-associated protein (VAP) (TC 9.B.17) family
Database Links

KEGG: ssc:100144536

STRING: 9823.ENSSSCP00000008012

UniGene: Ssc.17599

Pathway Cholesterol metabolism

Related Products

VAPB Proteins

VAPB Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.