Recombinant Pongo abelii Parathyroid hormone/parathyroid hormone-related peptide receptor(PTH1R)

Code CSB-CF732722PYX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5RAQ1
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Sequence DDVMTKEEQIFLLHRAQAQCGKRLKEVLQRPADIMESDKGWTSASTSGKPRKDKASGKLY PESEEDKEAPTDSRYRGRPCLPEWDHILCWPLGAPQGEVVAVPCPDYIYDFNHKGHAYRR CDRNGSWELVPGHNRTWANYSECVQFLTNETREREVFDRLGMIYTVGYSMSLASLTVAVL ILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQA PPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVF GWGLPAVFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLHFILFINIVRVLAT KLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLF NSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVTN VGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPATAAPKDDGFLNGS CSGLDEEASGPEQPPALLQEEWETVM
Source in vitro E.coli expression system
Gene Names PTH1R
Protein Names Recommended name: Parathyroid hormone/parathyroid hormone-related peptide receptor Alternative name(s): PTH/PTHrP type I receptor Short name= PTH/PTHr receptor Parathyroid hormone 1 receptor Short name= PTH1 receptor
Expression Region 29-594
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Database Links

STRING: 9601.ENSPPYP00000015578

UniGene: Pab.19774

Related Products

PTH1R Proteins

PTH1R Proteins for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.